KEGG   Pseudomonas cremoricolorata: LK03_19485Help
Entry
LK03_19485        CDS       T03354                                 

Definition
(GenBank) alpha-amylase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
psw  Pseudomonas cremoricolorata
Pathway
psw00500  Starch and sucrose metabolism
psw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LK03_19485
Enzymes [BR:psw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     LK03_19485
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     LK03_19485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap
Motif
Other DBs
NCBI-ProteinID: AIR91313
UniProt: A0A089YHY6
LinkDB All DBs
Position
complement(4226750..4230061)
Genome map
AA seq 1103 aa AA seqDB search
MAKRTRPAAFIDDPLWYKDAVIYQLHVKSFFDANGDGIGDFAGLISKLDYICELGVNTLW
LLPFYPSPRRDDGYDIAEYKAVHPDYGNLADARRFIAEAHKRGLRVITELVINHTSDQHP
WFQRARHAKPGSKARDFYVWSDSDQKYDGTRIIFLDTEKSNWTWDPVAGQYFWHRFYSHQ
PDLNFDNPQVLKGVMGVMRFWLDIGVDGLRLDAIPYLIERDGTNNENLPETHQVLKAIRA
EIDANYPDRMLLAEANQWPEDTRPYFGEGEGDECHMAFHFPLMPRMYMALAMEDRFPITD
ILRQTPEIPAKCQWAIFLRNHDELTLEMVTDRERDYLWNHYAEDRRARINLGIRRRLAPL
LQRDRRRIELLTSLLLSMPGTPTLYYGDELGMGDNIYLGDRDGVRTPMQWSPDRNGGFSR
ADPQRLVLPPVMDPLYGFQTVNVEAQSHDPHSLLNWNRRLIAVRNQQKAFGRGTLKTLTP
SNRRILAYLREYTDEAGNQEIILCVANVSRTAQAAELDLSPYVDKVPVEMLGGSAFPPIG
QLPFLLTLAPYGFYWFQLASRERMPSWHQEPAEALPELTTLVLRQRMEELLQAPGRDTLQ
QAILPQYLPKRRWFAGKEGPIDDIRLCYGTRFGTAETPVLLTEIEVLSNGVASRYQLPFG
LLREEHISSALPQQLALSRVRRGREVGLITDAFVLEPFIRQVLLACQQQSRLALEEGELQ
FHCTEQLAAHGIDEQTSVRYLSAEQSNSSVVVGESLVLKLIRRVNGGIHPELEMSAYLTQ
AGFANISPLLAWVSRVDAQAQPHLLMIAQGYLSNQGDAWAWTQNTLERAIRDELEADHQA
DQGHADAQAELAGFAALFGRRLGEMHLHLAAPSDDAAFAPQVSEAADSQRWASQISAELG
HALDLLQQHRAGLDLDSQALVDELLHKRDGLAEHVARLAEQARGGLLIRVHGDLHLGQVL
VVQGDAYLIDFEGEPSRPLEERRARHSPFKDVSGVLRSFDYAGAMILRSAAAGDLADSER
QARQRVARQYLHQSRQAFIDAYSLATADLPHVWAQAEGERAALELFSLEKAAYEITYEAE
NRPAWLAVPLHGLYGLISTWGES
NT seq 3312 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcgcacacgcccggcagccttcatcgatgatccgctgtggtacaaggacgcg
gtgatctaccagttgcacgtcaagtcgttcttcgatgccaacggtgacggcattggtgat
ttcgcagggctgatcagcaagctcgattacatctgcgagctgggcgtgaacacgttatgg
ctgctgccgttctatccctcgccgcgtcgcgacgatggctatgacatcgccgagtacaag
gccgtccaccccgactacggcaacctggccgatgccaggcgcttcatcgccgaggcgcac
aagcgtgggttgcgggtcatcaccgagctggtgatcaaccacacctccgaccagcacccg
tggttccagcgcgcgcgacacgccaagcccggcagcaaggctcgcgacttctacgtgtgg
tccgactcggaccagaaatacgacggcacgcggatcatcttcctcgacacggaaaagtcc
aactggacgtgggacccggtggccggccagtacttctggcaccgcttctattcccatcag
ccggacttgaacttcgacaacccgcaggtgctcaagggggtgatgggtgtcatgcgtttc
tggctggacattggcgtcgatggtctgcgcctggatgccattccgtacctgatcgagcgt
gacggcaccaacaacgagaacctgcccgagacccatcaggtgctcaaggccatccgcgcc
gagatcgatgccaactatcctgatcgcatgctgcttgccgaagccaaccagtggccggaa
gacacccgcccatacttcggtgagggcgagggcgacgaatgccacatggccttccatttc
ccgctgatgccgcgcatgtacatggccctggccatggaagaccgcttcccgatcaccgac
atcctgcgccagaccccggaaatcccggccaagtgccagtgggcgatctttctgcgcaac
cacgatgaactgaccttggaaatggtcaccgaccgtgagcgcgactacctatggaaccac
tacgccgaggatcgccgcgcgcgcatcaacctgggcatccgcaggcgtctggcgccgctg
ctgcagcgtgaccgccgccgtatcgaactgctcaccagcctgctgctgtcgatgcctggc
accccgaccctgtactacggtgacgagctgggcatgggtgacaacatctatctgggtgac
cgcgacggtgtgcgcacgcccatgcagtggtcgccggaccgcaacggcggattctcccgc
gccgacccgcagcgcctggtgctgccaccggtgatggacccgctgtatggcttccagacc
gtcaacgtcgaggcgcaatcccacgatccacattcgctgctcaactggaaccgtcggctg
atcgcggtgcgcaatcagcaaaaagcgttcggccgcggcacgctcaagacgctgacaccg
agcaaccggcgcatcctggcctacctgcgcgaatacaccgacgaggctggcaaccaggaa
atcatcctctgcgtggctaacgtttcgcgtactgcccaggcggcggagctggacctttcg
ccgtacgtcgacaaagtcccggtggaaatgctcggcgggagcgcttttccacccatcggc
caactgccgttcctgctgaccctggcgccctacggcttttactggttccagctggccagc
cgcgaacgcatgcccagctggcaccaggagccggccgaagcgctgcccgaactgaccacc
ctggtgctgcgccagcgcatggaggaactgttgcaggcgccggggcgcgacaccttgcaa
caggccattctgccgcagtacctgcccaagcggcgttggttcgccggcaaggaagggccg
atcgacgacatccgcctgtgctacggcactcgcttcggcacggcggaaacgccggtgctg
ctgaccgaaatcgaagtgctgagcaacggcgtcgccagccgctatcagttgccgttcggc
ctgctgcgtgaggaacacatcagcagcgcgttgccgcagcaactggccttgtcgcgggtg
cgccgaggtcgtgaagtggggctgatcaccgacgccttcgtgctcgagccgttcattcgc
caagtgctgctggcctgccagcagcagtcgcgcttggcgctggaggagggcgagttgcag
ttccactgcaccgagcaactggccgcccacggtatcgacgagcagacctcggtgcgctac
ctcagcgccgagcagtccaacagctcggtggtggtcggcgagagcctggtgctcaagctg
attcgccgggtcaatggcggcatccaccctgaactggaaatgagtgcctaccttacccag
gcaggttttgccaacatctcgccgctgctggcctgggtcagccgggtggatgcacaagcg
caaccgcacctgttgatgatcgcccagggctatctgagcaaccagggcgatgcctgggcc
tggacccagaacaccctggaacgggcgattcgtgacgagctggaggccgatcaccaggcc
gaccaggggcatgctgacgctcaggcggagttggccggattcgctgcactgttcgggcgg
cggctgggcgagatgcacctgcacctggccgcacccagcgacgacgcagcgttcgccccg
caggtcagcgaggcggccgacagccagcgctgggccagtcagatcagtgcagagctcggc
catgccctcgacctgctccaacagcatcgcgctgggctcgatctagacagccaggcgctg
gtcgatgagctgctgcataaacgtgatggcctggccgagcacgtcgcgcggctggctgaa
caggcgcgcggcggcctgctgattcgtgtgcatggcgacctgcacctgggtcaagtgctg
gtcgtgcagggcgatgcgtacctgatcgacttcgagggcgagccttcgcggcccttggag
gagcgccgagcgcggcatagccctttcaaagatgtcagcggcgtgctgcgttctttcgac
tatgctggcgccatgattctgcgcagtgccgcagccggcgacctggccgacagcgagcgc
caggcgcggcagcgcgttgcccggcaatacctgcatcagtcgcgacaagccttcatcgac
gcctacagcctggccactgccgacctgccccatgtctgggcgcaggccgagggcgagcgt
gcggcgctggagctgttcagtctggagaaggctgcctacgaaatcacttatgaagccgaa
aaccgtcccgcttggctggccgtgcctttgcatggcctgtatggactgatcagtacctgg
ggagagtcctga

DBGET integrated database retrieval system