KEGG   Paenibacillus swuensis: SY83_04155Help
Entry
SY83_04155        CDS       T04884                                 

Definition
(GenBank) membrane protein
Organism
pswu  Paenibacillus swuensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_1_like Sugar_tr MFS_2 MFS_4 OATP DUF1538 MFS_3
Motif
Other DBs
NCBI-ProteinID: ANE45626
UniProt: A0A172TFB3
LinkDB All DBs
Position
complement(964190..965425)
Genome map
AA seq 411 aa AA seqDB search
MKLKLPRLSLLKEFHPVVLVLLAGTVFARAASSMSLPFLAIYLHKTAGMDALTIGFIIGL
GSLTGTLGGFFGGHLSDKVGRKGVMLAAVYLWGLVFLGFALTKEPWLLALLNMLNGLCRS
WYEPVSQALMADVTDKEKRMRVFSLRYLAINIGVSVGPLLGATFGLLNADLPWILTGMFY
LTYGVSLHLLLNRFGIRRIEGEKKESTTLVKAMNILRQDKAFRYFIFGNIMVAIGYAQMM
STLSQYVGEQFSAAELFAWMMSLNAIIVIVFQLPFSRWSEKRTPQTAILAGSLLFALGHL
GFAYSTAWWGMLLAMAVFTFGEILAFPAETLLLDQISPEHMRGTYYGAQTLSSFGHALGP
WIGGYLLHEYGGTTLFVVIAVISVTAPVFFRLGARVKPGRAIDGSISKMQA
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttaagttaccgcggttatccctactgaaggagttccacccggtagtactggta
ttgcttgcgggcaccgtattcgctagggcggcgagctccatgagtttgccgtttctggcc
atttatttgcacaaaacagccgggatggacgcgctgaccatcggctttattataggtttg
gggtcgctgacaggaacgttgggcggattctttggcggccatctttcggataaggtgggg
cgcaaaggcgttatgctggcggccgtttacctgtggggacttgtgtttctgggttttgcg
ttgaccaaagagccttggcttctcgccttgctgaacatgctgaacggtttatgcaggtca
tggtacgagccggtatcccaagcgctgatggcggatgtcacggacaaggagaagcgaatg
cgtgtgttctctctgcgatatttagccattaacattggcgtatcggtaggaccgctgcta
ggggcaaccttcggtttgctgaatgcggatcttccgtggatcctgacaggtatgttctac
ctgacctatggtgtgtcgcttcacctcttgttgaatcgcttcgggattcgccggatcgaa
ggggagaagaaggaaagcaccacactagtgaaagctatgaacatattacgccaggacaag
gctttccggtatttcatcttcggtaacattatggtggcgatcggttatgcccaaatgatg
tccacgttatctcaatacgtgggcgaacagtttagcgcggcggagctttttgcctggatg
atgagcttgaacgcgatcattgtcatcgtatttcaacttccgttctcgcgttggagcgag
aagcgaacgccgcaaaccgcgatactggcagggtccttgctgtttgcgctgggccatctc
ggttttgcttactccacggcatggtggggcatgctgctggctatggcggtgtttacgttc
ggtgaaatcctcgcctttccggccgaaaccttgcttctggaccaaatttcacctgaacat
atgcgggggacctactacggagcgcagacgctttcttcattcggccacgcattgggtcct
tggattgggggttacctgcttcatgaatacggcggcacgaccctgtttgttgtgattgct
gtcatttccgtaacggctccggtctttttccggttgggtgcgcgggttaagccaggccga
gcgattgacggatcgatttccaagatgcaagcctaa

DBGET integrated database retrieval system