KEGG   Paenibacillus swuensis: SY83_08915Help
Entry
SY83_08915        CDS       T04884                                 

Definition
(GenBank) 30S ribosomal protein S6 modification protein RimK
  KO
K05827  [lysine-biosynthesis-protein LysW]---L-2-aminoadipate ligase [EC:6.3.2.43]
Organism
pswu  Paenibacillus swuensis
Pathway
pswu00300  Lysine biosynthesis
pswu01100  Metabolic pathways
pswu01210  2-Oxocarboxylic acid metabolism
pswu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pswu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    SY83_08915
Enzymes [BR:pswu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.43  [lysine-biosynthesis-protein LysW]---L-2-aminoadipate ligase
     SY83_08915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RimK GSH-S_ATP ATP-grasp ATPgrasp_ST TTL ATP-grasp_2 ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: ANE46380
UniProt: A0A172TH83
LinkDB All DBs
Position
complement(2030677..2031564)
Genome map
AA seq 295 aa AA seqDB search
MENSSTVLLCVTKLREEERRIMDYLSRLGIRVQVNLDSMELPVGASDVPSFGVALIRCLS
QKNAISRTQLLELAGLETLNSGKAITICTNKIHQAIVFDKHGIPQPRFQVVFTPAKLFDA
LQKFGDLCVIKPATSSWGRGIARVTGKECLEGWIAARESVDPSHQSFPVLVQEYVEKGDH
DIRVVIVGRKPIVAFRRVSAENWKTNTHLGAEIEPIEINREIASICGDLVAVLGKGIYGA
DLFFDYQKLCYVVCEVNQNPEFAKSWKIHGVDVAHHIAEYVKEKIDTKIKVNVTV
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggagaatagcagcacggtcttgttgtgcgtaacgaagctaagagaagaagagcggcgg
atcatggattacctgagtcgtctcggcatccgagtccaagtgaacttggactccatggaa
ttgcccgtcggtgcatccgatgtcccttccttcggggttgctctcatccgatgcctttct
cagaaaaatgcgataagtcgtacccagctccttgagcttgccggactggaaacgttaaat
tcgggcaaagccattacgatttgcactaataaaattcatcaggccatcgtgttcgacaaa
cacgggattccacagccgcggtttcaagtagtctttacccccgcaaagctgtttgatgct
cttcagaagttcggggatttatgcgtcattaaacccgcaacctcatcatgggggcgggga
attgccagagtgacggggaaggaatgcctggagggctggattgctgccagggagtcggtg
gatccgagccatcaatcgttccccgttctcgtgcaagagtacgtcgagaaaggggatcac
gacattcgagtcgtgattgtgggccgaaagccgatcgtcgcatttcgccgagtttcagcg
gagaactggaagacgaacacgcatcttggggcggagatcgaaccgatcgagatcaatcgc
gagatcgcctcgatttgcggtgatttagtcgccgtattagggaaaggcatttacggcgca
gatttatttttcgattaccagaagctgtgttacgtcgtatgtgaagtgaatcagaatccc
gaattcgcgaagtcttggaaaatacatggcgtggatgtcgcccatcatattgcagaatat
gtgaaggagaagatagataccaaaatcaaggtcaatgttacggtttaa

DBGET integrated database retrieval system