KEGG   Paenibacillus swuensis: SY83_13210Help
Entry
SY83_13210        CDS       T04884                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
pswu  Paenibacillus swuensis
Pathway
pswu00473  D-Alanine metabolism
pswu01100  Metabolic pathways
pswu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pswu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SY83_13210
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    SY83_13210
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pswu01011]
    SY83_13210
Enzymes [BR:pswu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     SY83_13210
Peptidoglycan biosynthesis and degradation proteins [BR:pswu01011]
 Precursor biosynthesis
  Racemase
   SY83_13210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ANE47065
UniProt: A0A172TJ32
LinkDB All DBs
Position
2994001..2995200
Genome map
AA seq 399 aa AA seqDB search
MESYYRPTRAEIDLNALEHNLNEFRNRLPAGQKIMATVKANAYGHGAVGIAKAAVRWGVD
YLSVAFLDEAIQLRQAGIASPILVLGHTPAEGIQAAIDHDITLNVYTNDVLEAAECCYAS
KEKGTGQPLRIHVKVDTGMGRIGILAEDAVPFIQKAMGMPGVRVEGVFTHFACADEADLS
YTHMQYQRFQKVLDTFEAQGVSFPLIHTGNSAAAIQVPEWSYSMVRLGISMYGLYPSDEV
PADWVDLKPVMRIVSRLSNVKTLPPGEGISYGVRYYTQTQERIGTVPIGYADGYSRMLTG
KAEALVRGQRVPVVGTICMDQCMLNLTILPEEGMDVGIGEEVVLMGRQGDLVISAEDIAA
HLGTINYEVTCMVAHRIPRVYLREGRPEEVVHALMPVEG
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggagagttactatcgtcccacccgggccgaaattgatttaaatgcgctcgagcataat
cttaacgaattcagaaacaggctgccggccggtcagaagatcatggctacggtgaaggcc
aacgcttacgggcacggtgcagtcggcatcgccaaagcggcagtgcgatggggcgttgat
tatttaagcgttgcctttctggatgaagcgattcagttgcgtcaagcgggtattgcttca
ccgattcttgtcctggggcatacgcccgccgaggggattcaagccgccatcgatcatgat
attactttaaatgtgtacacaaatgatgtattggaagcagcggaatgctgttatgcaagc
aaggagaaggggaccgggcagccgttgcggattcatgtgaaggtggatacgggcatgggc
cggattggtattctggcagaggatgccgtcccttttatacagaaagcgatgggtatgcct
ggggtgagggtagaaggggtattcactcatttcgcctgtgcggatgaagcggatttaagt
tacacgcatatgcaataccaacggtttcaaaaggtgctggatacattcgaggcccaaggc
gtatcgtttccgttgatccacaccgggaatagcgcagccgcgattcaggttccggaatgg
agctattccatggtccggctgggcatcagcatgtacggcttatatccttcggatgaggtg
cccgcggattgggtggatttgaagccggtcatgcgcattgtgagccgattgtccaatgtg
aaaacactccctccaggcgagggtatcagctatggcgtaagatattatacgcagacgcag
gaacgcatcgggaccgtaccgatcggctatgccgacggatactccagaatgctgacaggc
aaagcggaagctttggtacgaggtcagcgggtaccggttgtaggcaccatatgcatggat
cagtgcatgttgaaccttacgattttgcctgaagagggaatggatgttgggatcggggaa
gaagtcgtcctgatgggccggcaaggagatttggtgatctcagcggaggacattgcggct
catttgggtacgattaactacgaggttacgtgcatggtagctcaccggattccgcgggtt
tacttgcgtgaagggcgtcccgaagaggttgtacacgcgctgatgcctgtcgaaggataa

DBGET integrated database retrieval system