KEGG   Paenibacillus swuensis: SY83_13965Help
Entry
SY83_13965        CDS       T04884                                 

Definition
(GenBank) ATP-dependent DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pswu  Paenibacillus swuensis
Pathway
pswu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:pswu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    SY83_13965
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pswu03400]
    SY83_13965
Enzymes [BR:pswu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SY83_13965
DNA repair and recombination proteins [BR:pswu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SY83_13965
    RecFOR pathway proteins
     SY83_13965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH HHH_8 IMS_HHH Cdd1 Bro-N
Motif
Other DBs
NCBI-ProteinID: ANE47187
UniProt: A0A172TK44
LinkDB All DBs
Position
3168240..3168875
Genome map
AA seq 211 aa AA seqDB search
MIDFLRGRVAHRETEYIVMDVQGVGYRVFCPNPYAIGLKGEAETIVYIHHSVREDAILLF
GFPAREEQTLFRRLLDVSGIGPRVALGILAGGKPDAVVAAIQQENVTFLTKLPGIGKKTA
QRMILDLKDKLDAMPPAGMEIASGSEGTGSDSRLDYAGGNAWYEAKEALMALGYSETETD
RAWSSIKNKVDGENDGVDVIMKKALQALFSG
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgattgattttttgcgcggacgcgtggcgcaccgcgagacggaatatattgtaatggac
gtacaaggggtgggctacagggtgttctgtccgaacccttacgccattggcttgaagggt
gaagccgaaacgatcgtatacattcatcacagcgtaagggaagatgccatccttctgttt
ggatttcccgctcgcgaagagcagaccttgttccgccggctgttggatgtttccggaatc
ggaccgcgtgtagcccttggtatccttgcgggaggtaagcccgacgcggtggtcgcggcc
attcagcaagagaatgtaacgttcctgaccaagcttccagggattggtaagaagacggcc
caacggatgattctcgacttaaaggacaagctcgatgctatgcccccggccggtatggaa
attgcaagcggctccgaaggaaccggttccgacagcaggctggattatgccggcggcaac
gcctggtatgaagccaaggaagctctaatggcgttgggttattccgaaactgagacagat
cgggcatggagctcaattaagaacaaggtggacggggagaacgacggtgttgacgtgatt
atgaagaaggcgctgcaggctcttttttcggggtag

DBGET integrated database retrieval system