KEGG   Paenibacillus swuensis: SY83_13990Help
Entry
SY83_13990        CDS       T04884                                 

Definition
(GenBank) preprotein translocase subunit YajC
  KO
K03210  preprotein translocase subunit YajC
Organism
pswu  Paenibacillus swuensis
Pathway
pswu02024  Quorum sensing
pswu03060  Protein export
pswu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pswu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    SY83_13990
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SY83_13990
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SY83_13990
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pswu02044]
    SY83_13990
Secretion system [BR:pswu02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   SY83_13990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YajC Orf78 T2SSM
Motif
Other DBs
NCBI-ProteinID: ANE47192
UniProt: A0A172TJP0
LinkDB All DBs
Position
3174346..3174690
Genome map
AA seq 114 aa AA seqDB search
MNLLVAAEEPAGLFGGGIGAFLPLILMFAVFYFLLIRPQQKKQKQRNSMLSAIKKGDKVV
TIGGLHGTVLEMNEDTVVLRVNDATKLTFDRSAVNTIVSSAPAASVTPSLTKED
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgaatttattagtagcggcagaagaacctgcagggttgttcggcggaggtatcggagca
tttcttcctttgattctcatgttcgcggtattttacttcttactgattcgcccgcagcag
aagaaacagaagcaacgcaactccatgttatccgcaatcaagaaaggtgataaagtcgtc
accattggcggtttacacggtactgtgcttgaaatgaatgaagatacggttgtgcttcgt
gtgaacgacgcaacgaagttgacgttcgaccgcagcgcggtcaacacaatcgtgagcagc
gcgcctgccgcatcggttacaccttcgttaacgaaagaagattaa

DBGET integrated database retrieval system