KEGG   Paenibacillus swuensis: SY83_15680Help
Entry
SY83_15680        CDS       T04884                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pswu  Paenibacillus swuensis
Brite
KEGG Orthology (KO) [BR:pswu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pswu01001]
    SY83_15680
Enzymes [BR:pswu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SY83_15680
Protein kinases [BR:pswu01001]
 Serine/threonine kinases: Other
  Bacterial family
   SY83_15680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kinase-like RIO1 Kdo YrbL-PhoP_reg FTA2 Haspin_kinase Seadorna_VP7 KIND Pkinase_fungal Fructosamin_kin
Motif
Other DBs
NCBI-ProteinID: ANE47483
UniProt: A0A172TL30
LinkDB All DBs
Position
3545385..3547556
Genome map
AA seq 723 aa AA seqDB search
MIGLELGGRYEIISRIGGGGMALVYKGHDILLNRKVAVKVLRQQFVHDEEFIRRFRREAQ
SAASLSHPNVVSIYDVGQEDEIHYIVMEYIDGHNLNEIIQERAPLQAEESVRVASQICDA
LEHAHQNHIIHRDIKPHNILIGKNGRVKVTDFGIARAVTSSTITQTGSVIGSVHYFSPEH
AKGVVTGEKSDLYSLGIVLYQMLTARLPFLGESPISVALKHLQEQLEEPRRVNPSIPQSV
ENVILKAMRKNPEERYQSATEMLKDLETCLRPERVSEPKIAFATFDDGEQTRVMTAIKPE
QLAAYKAANGNTSPGAVAASSKGSTSGSPPPKKKTWVKPFSWIFGTILLLLLMWFGVQWV
QSILRVPEVAVPNLTGMTLDEARAELIKSGLGVDEPPLYKIDEEVPKDVVLSYDKQGMLV
RKGDTIKLTVSKGIPLILLSDYEGQQYKDVKASLIAQGVQEELISDDQVFSDEEAGTIVG
QSIPANQEMNPKKDALEFTVSKGRETFKMPNLIGFSEAEAKAIAIQNNLRISDANVKSEP
SYSPKGVVFRQWPYEPNQPVAENSEVTIYVSSGYPSDALFYTFNVTVSPAILGQESTVKI
VYSDARGDNMEWGTKKLKDVQTYPVELVLSPTKDGVISIYRDGKLADSATVSYDGAVNGD
QPTMTIPGAEAEPVQGAETPSEEVKPPAEGTTEPPAAQDNGKGKGKDKNKDKKNNDSNDN
EDD
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgatcggattagaattaggcggacgttatgagattatttccagaatcggcggcggcggc
atggcattggtgtacaaggggcatgatattctgctcaatcgcaaagtcgccgtcaaagta
ttaagacaacagttcgtacacgacgaggagttcatccgccgtttccgcagggaagcccag
tccgcagcgtctttatcccatcccaatgttgtaagcatctacgatgtcgggcaggaagat
gaaattcattatattgttatggaatatattgacggtcataatcttaatgaaattatacag
gaacgcgcaccgcttcaagccgaagaatccgttcgagttgcttcgcaaatttgcgacgcc
ttggagcatgcccatcagaaccatattattcatagagatattaagccccacaacattctc
attggcaaaaacggccgtgtgaaggtaacggatttcggaatcgcgcgcgccgtgacctcg
tcaacaattacacagaccggttctgttatcggttccgttcattatttctcacctgaacat
gctaaaggtgtggttacgggagagaaatcagacctatactcgttgggcatcgtgttgtat
caaatgttgaccgcgcgtctgccgtttcttggggaaagcccgattagcgtggcgcttaag
catctgcaggaacagttggaggagcctcgcagagtcaatccttccataccgcagagtgtg
gagaatgtcatcttgaaagccatgcgtaaaaatccggaggaacgttatcaatccgccaca
gagatgcttaaggatttggagacctgtcttcgtccggaacgggtcagtgaaccgaagatc
gccttcgcgacctttgatgacggcgaacaaactcgtgtaatgaccgccattaagcccgag
caattagcagcgtataaagcggctaacggaaatacgagtccaggtgcggtagcggcatcc
tctaaaggatcaacctccggttcgcctcctcccaagaagaaaacttgggtgaagcccttt
tcatggatctttggaaccattctgctcttgttattgatgtggtttggcgttcaatgggtg
caaagtattctgcgtgtacctgaggttgcggttccgaacttaacagggatgacgttagat
gaagctcgcgctgaactgatcaaatccggtcttggggttgacgaaccgccgttgtacaag
atcgacgaagaggtgcctaaggacgttgtgttatcatatgacaagcagggtatgctggta
aggaaaggcgacacgattaaacttacggtcagcaaaggaattccgttgattttactgtcc
gattatgaaggacaacagtataaagatgtgaaagccagcctgatcgctcaaggtgttcag
gaggaacttatttcggatgatcaagtcttttccgatgaagaggccggaacgattgtgggt
cagtccatccctgccaatcaagagatgaacccgaagaaagacgctcttgaatttaccgta
agcaagggcagagagaccttcaaaatgcctaacttaattggattcagcgaggctgaagcc
aaagcgatcgcgattcagaacaatcttcgaatatcggatgcgaacgtgaaatcggagcct
agttattctccgaaaggagttgtcttccggcaatggccatatgagccgaatcagccggta
gctgaaaattccgaagtgacgatttatgtttcgtccggctacccaagcgacgccctgttc
tatacattcaatgtgacggtttcacctgcgattcttggtcaggagagcaccgttaagatc
gtatacagcgatgccagaggcgacaatatggagtggggaacgaagaagcttaaggatgtt
cagacctatccggttgaacttgtgctctcaccgacgaaagacggggttatcagcatttat
cgggatgggaaattggcggattcggcaacggtaagttatgacggcgctgttaacggcgat
cagccgaccatgacgattcctggcgccgaagccgaacctgtgcaaggtgccgaaacccct
tcagaagaagtaaaacctcctgctgaaggaacaacggagccaccggcagcacaagataac
ggcaagggcaagggtaaggacaagaacaaagacaagaaaaataatgactcaaatgataat
gaggacgactaa

DBGET integrated database retrieval system