KEGG   Paenibacillus swuensis: SY83_17590Help
Entry
SY83_17590        CDS       T04884                                 

Definition
(GenBank) dienelactone hydrolase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pswu  Paenibacillus swuensis
Pathway
pswu00010  Glycolysis / Gluconeogenesis
pswu00020  Citrate cycle (TCA cycle)
pswu00620  Pyruvate metabolism
pswu01100  Metabolic pathways
pswu01110  Biosynthesis of secondary metabolites
pswu01120  Microbial metabolism in diverse environments
pswu01130  Biosynthesis of antibiotics
pswu01200  Carbon metabolism
Module
pswu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pswu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SY83_17590
   00020 Citrate cycle (TCA cycle)
    SY83_17590
   00620 Pyruvate metabolism
    SY83_17590
Enzymes [BR:pswu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SY83_17590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 GCV_H ATP-synt_ab_Xtn Transferase
Motif
Other DBs
NCBI-ProteinID: ANE47798
UniProt: A0A172TL82
LinkDB All DBs
Position
complement(3939897..3941249)
Genome map
AA seq 450 aa AA seqDB search
MAIYKYPFPELGEGIHEGEIVKMLIKPGQTVTDEDIIMEVQNDKAIVEVPCPVNGKIVEV
LVKDGQICHVGDTVATIEVEGELPAGAETAEAEETAPNESVATGGADVKQDTPVPAESKD
AASGAIAQTPAAATAAPEKTSGEVLATPSVRKFAREKGVNLSQLSGTGKNGRITREDVEG
FNGAAPAPAAETTPVADAEAAPTETAKATPAAAVVTGGAEERIPFKGIRKAIANAMVKSV
YTAPHVTIMDEVDVTKLVDFRTKLKPAMEKKGIKVTYLPFIVKALVAACREFPIMNSTID
EAANEIVYKKYYNIGIAADTDNGLVVPVVHEADRKNVWNVANEIKELAGKARDGKLAPAE
MKGGTITISNIGSAGGMFFTPVINFPEVAILGTGRITEKAIVKNGEIVAAPVMALSLSFD
HRVIDGATAQNFMNYIKNLLADPELFMMEV
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
ttggctatttacaaatatccattcccggagcttggtgaaggcattcacgaaggtgaaatc
gtcaaaatgcttatcaaaccaggccaaacggtaactgacgaagatattattatggaagta
cagaatgacaaggcgattgttgaagtgccatgtccggtgaacggcaagatcgttgaagtg
cttgtgaaggacggacaaatctgtcacgtcggcgacacggtagcaaccattgaagtggaa
ggcgaacttcctgccggcgccgaaaccgcagaagcagaagaaacagcgccgaatgaatcc
gttgcaacaggcggagcagacgtgaaacaagatacacctgtaccggctgagagcaaggat
gctgcttccggtgcgatcgcacaaacgcctgcggctgctacggcggctcctgaaaaaact
tccggcgaagttttggctacgccaagcgttcgtaaattcgctcgcgagaaaggtgtaaat
ctttctcagcttagcggaacaggcaagaacggccgtattacccgtgaagatgttgaaggc
tttaacggcgcggctccagcacctgctgctgaaactacccctgttgccgacgcggaagca
gctccaacggaaacagctaaagcaacaccggcagcggctgttgttacaggcggcgcggaa
gagcgcataccgtttaaagggatacgcaaagcaatcgctaacgctatggttaaatctgta
tacacggcacctcacgttaccattatggacgaagtggatgttacgaagcttgttgacttc
cgtacgaagctgaagccggcgatggagaagaagggtattaaagttacttacttgcctttc
atcgtgaaagcattggtggcggcttgccgtgagttcccgattatgaactcaacgattgac
gaagctgcgaatgagatcgtctacaagaaatattacaatatcggtatcgcggcagataca
gacaacggtttggtcgttcctgtagttcatgaagcggatcgtaagaatgtatggaatgtt
gcgaacgaaattaaagaattggctggcaaagctcgcgacggaaaactcgctcctgctgaa
atgaagggcggaacgatcacaatttccaatatcggttcggccggcggcatgttcttcaca
cctgtaatcaacttccctgaagttgccattctgggtacaggccgcattacagagaaagcg
atcgtgaagaacggtgagattgtagccgctccggttatggcgctttcattgagtttcgac
catcgtgtaattgacggtgcgacagcacaaaacttcatgaactacattaagaacttgctc
gcagatcctgaattattcatgatggaggtgtaa

DBGET integrated database retrieval system