KEGG   Paenibacillus swuensis: SY83_20280Help
Entry
SY83_20280        CDS       T04884                                 

Definition
(GenBank) dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
pswu  Paenibacillus swuensis
Pathway
pswu00040  Pentose and glucuronate interconversions
pswu00051  Fructose and mannose metabolism
pswu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pswu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SY83_20280
   00051 Fructose and mannose metabolism
    SY83_20280
Enzymes [BR:pswu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     SY83_20280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: ANE48241
UniProt: A0A172TMH4
LinkDB All DBs
Position
complement(4490230..4491276)
Genome map
AA seq 348 aa AA seqDB search
MKAAVLHGISDLRVEDIGMPSPGAGEVLVKVRACGVCGSDIPRVFTKGTYSFPTVPGHEF
AGEISAVGEGVDASLIGMRAAVFPLLPCRSCPSCEIGDYATCSNYDYMGSRSDGAFAEYI
ACPLWNIVPAPAALSYEEIAMAEPAAVAIHALRQAKIDIGDAVFISGAGPIGIMLGLWAK
AWGASRVLLADIDPEKLAFAREQGFEHTVNAFEQDVQAWVRSVTNDRGADVCVEGAGSSP
SWENCLKAARSGGRVVLMGNPAGEMKLSQNGYWEILRKQLTVSGTWNSSYASMPKNEWKL
ALDFMVAGRLNLKGLITHRTDLDGLREAMEMMRDRTAFYNKVMYTNLS
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagctgttctgcacggcatttccgacttgagggtagaggacatcggcatgccg
tcaccgggggccggtgaagttctcgtaaaggtccgcgcctgcggcgtatgcggctccgac
attccgcgcgtcttcacgaaaggcacgtattcgttcccaacggtgccgggacatgaattc
gcgggagaaatatcggctgtcggcgagggcgtcgacgcctctctgatcggcatgcgcgcc
gcggtgttcccgctcctcccttgccgcagctgcccttcctgcgaaattggcgactatgcc
acctgttcgaattatgactacatgggatcccgctcggacggggctttcgcggaatatatc
gcttgtccgctgtggaacatcgttcccgcgccggctgcgttaagctacgaagagattgcc
atggcggaacctgcggcggtcgccatccatgcgctccgacaggcgaagatcgacatcggc
gacgccgtcttcatcagcggcgcaggtccgatcggcatcatgctcggactgtgggcgaag
gcgtggggcgcaagccgcgttcttcttgcggatatcgaccctgagaagctggcattcgcc
cgcgaacagggcttcgagcacacggtgaacgcgtttgagcaggatgtgcaagcatgggtg
cgctccgtgacgaatgaccgcggggcagacgtctgtgtcgaaggagccggttcttcgccg
tcatgggagaattgcctcaaggcggcgcgttccggcggccgtgtcgtgctgatgggcaat
ccggccggcgagatgaagctttcccagaacggatattgggaaatattgcgcaagcagctt
accgtgagcggcacctggaattcgtcgtatgcgagcatgcccaagaacgaatggaagctg
gcgctggacttcatggttgcaggtcggctcaacctgaaaggactaatcacacaccggact
gatctggacggtttgcgcgaagcgatggagatgatgcgcgaccggacggcattttataac
aaagtcatgtatacgaacttatcctaa

DBGET integrated database retrieval system