KEGG   Paenibacillus swuensis: SY83_21560Help
Entry
SY83_21560        CDS       T04884                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pswu  Paenibacillus swuensis
Pathway
pswu00020  Citrate cycle (TCA cycle)
pswu00480  Glutathione metabolism
pswu01100  Metabolic pathways
pswu01110  Biosynthesis of secondary metabolites
pswu01120  Microbial metabolism in diverse environments
pswu01130  Biosynthesis of antibiotics
pswu01200  Carbon metabolism
pswu01210  2-Oxocarboxylic acid metabolism
pswu01230  Biosynthesis of amino acids
Module
pswu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pswu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pswu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SY83_21560
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SY83_21560
Enzymes [BR:pswu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SY83_21560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh DUF5043
Motif
Other DBs
NCBI-ProteinID: ANE48438
UniProt: A0A172TN21
LinkDB All DBs
Position
complement(4774494..4775789)
Genome map
AA seq 431 aa AA seqDB search
MPQFDKYTLPTEGQPITIDNGVLNVPNNPIVPFIEGDGTGPDIWAASQRVLDAAVEKAYG
GEKKIAWYEVFAGEKSFNQYGEWLPADTLTAIREYIVAIKGPLTTPIGGGIRSLNVALRQ
ELDLYVCLRPVRYFDGVPSPVKRPELVDMVIFRENTEDIYAGIEYQEGSEQVKKVLAFLQ
QEMGVNKIRFPETSGIGIKPVSAEGSKRLVRAAVEYAIAHGRKSVTLVHKGNIMKYTEGA
FKNWGYEVAEAEFGDKVFTWDQYDRIKADKGVDAANAAQKEATDAGKILVKDAIADIALQ
QVLTRPTDFDVIATLNLNGDYLSDALAAQVGGIGIAPGANINYVTGHAIFEATHGTAPKY
AGLDVVNPGSVILSGVMLLEHLGWQEAADLIYKGMTASINNKTVTYDFARLMEGATEVKC
SEFANQIISNM
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgccccaatttgacaaatacacattaccgaccgaaggacaacctataacaatcgacaat
ggtgtcttgaacgtgcctaacaatccgatcgtgcctttcattgaaggagacggaacaggt
cctgacatctgggcggcttcccaacgtgtgttggatgcggctgttgagaaagcatacggc
ggcgagaagaaaatcgcatggtacgaagtattcgcgggcgagaaatccttcaaccaatac
ggtgagtggttgccggcagatacacttacagcgattcgcgagtacatcgttgcgattaaa
ggtcctttgacaacgccgatcggcggcggaatccgttccctgaacgtagctcttcgtcaa
gagctggatttgtatgtttgcttgcgcccagtgcgttatttcgacggcgtgccttctccg
gtgaaacgtcctgagctggtagatatggttatcttccgtgagaacacagaggatatctat
gcgggtatcgagtatcaagaaggttccgagcaagtgaagaaagtgcttgccttcctgcaa
caggaaatgggcgttaacaagattcgtttccctgaaacttccggaatcggcatcaagcct
gtatccgctgaaggttccaagcgtcttgtccgcgcggcggtagaatacgcaattgcacac
ggacgtaagagtgtaacgcttgttcacaaaggtaatatcatgaaatacactgaaggagct
ttcaaaaactggggctacgaagtggctgaagctgaattcggcgacaaagtgttcacatgg
gatcaatacgaccgcattaaagcggacaaaggtgtagacgcggcgaatgctgctcagaag
gaagctacggatgctggcaagattcttgtgaaggatgccatcgctgatatcgcgcttcaa
caagtgttgactcgtcctacggatttcgatgttatcgctacattgaacctgaacggtgac
tacctgtctgacgcattggcagcacaagtgggcggcatcgggattgcacctggcgccaac
atcaactacgtgacaggtcacgcgatcttcgaagctacgcacggtacagcgcctaagtac
gctggtcttgacgtggtaaaccctggatccgttatcctttccggcgtaatgttgcttgag
cacctgggctggcaggaagcggctgacctgatctataaagggatgaccgcatccatcaat
aacaaaaccgtaacttacgacttcgcccgtctgatggaaggcgcaaccgaagtgaagtgc
tcggagttcgctaaccaaatcatttcgaatatgtag

DBGET integrated database retrieval system