KEGG   Providencia stuartii ATCC 33672: DR96_1259Help
Entry
DR96_1259         CDS       T03282                                 

Definition
(GenBank) glycosyl hydrolases 15 family protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
psx  Providencia stuartii ATCC 33672
Pathway
psx00500  Starch and sucrose metabolism
psx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DR96_1259
Enzymes [BR:psx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     DR96_1259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AIN63329
LinkDB All DBs
Position
1364191..1366500
Genome map
AA seq 769 aa AA seqDB search
MIAQQAPGAPGSTATWTSSAKDMVGTAIGQGRVWFTVGYGILNEVYWPSCSTPQIRDLGF
IIAGDDFWSEVKRVHQYSITTPSSSLPLPKIVHQHERYRLELEIITDPARDVLLIHYHLE
GEGLRLYPLLAPHLGGDGDNNYGSVTPQGLAAQKNGQYLILSAENGFARGSVGYVGSSDG
WQDFSQNGGMSWEYQQAGPGNIAMIGELNHNSGVLALAFSASAQGAATLANSALAEGYQE
ARRQYAYLWAAWNETVNFPGLDKLPKTLSDAVRTSVVVLKTHEGRTFPGSLVASLSTPWG
DTHKDPGGYHLVWPRDSVEVGFAMLACGLITEVRALLAYLIAIQQLDGHWMQNNFTDGRP
YWQGIQLDEVALPVLFAAKLHEQGLLGEMQGAAIRMARKALAFIAQYGPASPQDRWEENS
GINPFTLSVSIAALVAGAKAGFLEDGDKQYALDLADDWNERLESWVYVANTELDKELGIS
GHYIRLNPNCHSARFGEVMLRNRNNETINTRALLGMEYLYLVRLGLRKASDKRIEETTKL
VDEQLCVNLPAGPYYYRYNEDGYGEHEDGRAFDGSGVGRLWPLLSGERGHYAAARKEDIK
PYLNAILASASTGGMLPEQIWDKESIPERGLLTGRPSGSAMPLIWAHAELIKLIYVQKTG
VPIEQLKSVSERYGNKPPAPRARHWRDNLSCGAIPANRQLWIEAQEPFVLHYGYDNWQDI
KEQSSQPLGLGLYGVALDVSALAGKTLQFTRRFDAKGWEGRDWQVEIEV
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atgatagcacagcaagccccgggcgccccgggaagcactgcgacgtggacaagtagtgca
aaagacatggtgggaacggcaatcggtcaaggacgagtatggtttaccgtaggttatggc
atcttaaatgaggtgtattggccttcttgcagtacgccacaaattcgtgatttaggtttt
attattgctggggatgacttttggtcagaggtaaagcgtgtccaccaatacagtatcact
acgccgtcatcctccttaccactgccaaaaatcgtgcatcaacatgagcgttatcgcctt
gaattagaaattatcactgatcctgcgcgcgatgtcttgctgatccattatcatcttgaa
ggtgaagggctgcgattatatccgctattagcaccacatctcggcggcgatggtgacaat
aattatggttcggtgacgcctcaagggctagcggctcagaagaacgggcaatatctgatc
ttgtctgctgaaaatggctttgcaagaggcagtgtggggtatgttggtagctcagatggt
tggcaggattttagtcaaaacggtggtatgagttgggaataccagcaggctgggccaggt
aatatcgcgatgataggcgagttaaatcataactcaggcgtattggcgttagcattttct
gccagtgcgcaaggtgctgcaaccttagctaatagcgccctagcagagggctaccaagaa
gcaaggcgccagtatgcttatttgtgggcggcatggaatgaaacggtgaatttccctggg
ttagataagctgcctaaaacgttatcggatgctgttcgcacttcggttgtggtcttgaaa
acccatgagggtagaacattccccggctcgctggtggcgagtttaagtacgccatgggga
gatactcataaggatccgggaggatatcaccttgtttggcctcgtgactccgttgaagtc
ggttttgccatgttggcgtgtggtttgatcactgaggttcgagctttactggcttacttg
attgctattcaacagctagatggtcattggatgcaaaacaatttcaccgatggtcggcct
tattggcaggggatccaattagatgaagtggcattgcctgttttatttgcagcgaaattg
catgaacagggcctactgggggaaatgcaaggtgcggcaatccgcatggcgcgcaaagcg
ttagcctttattgcgcaatatggcccagccagcccacaagaccgctgggaggagaattca
gggatcaacccatttacgctgtcggtttcgatagcagcattggtggctggcgccaaagcg
ggcttccttgaggatggagataagcagtatgcgcttgacttagcggatgattggaatgag
cggttagaatcatgggtgtatgtggctaacacggagttagataaagagcttggtatctct
gggcattacatccgcttgaatccaaattgccattctgcacgttttggtgaggtgatgttg
cgcaaccggaacaatgaaaccatcaatacgcgtgcgttattagggatggaatatctctat
cttgttcgcttaggtttacgtaaggcatcagataagcggattgaagagacgactaaactt
gttgatgagcaactgtgtgtcaatttacccgcggggccatattattatcgttataacgag
gatggatatggcgagcatgaggatgggcgtgcttttgatggtagtggtgtaggtcgtctt
tggccgttactcagtggggagcgagggcactatgccgccgcccgtaaagaggatattaag
ccttatttaaatgccattttggcttcagcaagtacaggtggtatgttgccggagcaaatt
tgggataaggagagtatacctgagagggggctattaacgggtaggccaagcggtagtgcg
atgccactgatttgggctcatgcggagcttatcaagttaatctatgtgcaaaagacgggt
gtgcctattgagcaactaaaatcggtgagtgagcgttatggcaataaacctccagcacca
cgcgcacgtcattggcgtgataatttatcttgtggtgcgatacccgccaatcgccagtta
tggattgaagcacaagagccatttgttttgcattatggttatgacaattggcaggatatc
aaggagcagagtagccaacctctcggtttagggttatatggtgttgcgttagatgtcagc
gcattggcaggaaaaacactacaatttacgcgtaggtttgatgctaagggctgggaagga
cgtgactggcaagttgagatagaggtgtag

DBGET integrated database retrieval system