KEGG   Providencia stuartii ATCC 33672: DR96_1326Help
Entry
DR96_1326         CDS       T03282                                 

Gene name
glpD
Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
psx  Providencia stuartii ATCC 33672
Pathway
psx00564  Glycerophospholipid metabolism
psx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psx00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    DR96_1326 (glpD)
Enzymes [BR:psx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     DR96_1326 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 FAD_oxidored NAD_binding_8 3HCDH_N Lycopene_cycl GIDA HI0933_like
Motif
Other DBs
NCBI-ProteinID: AIN65148
UniProt: A0A1L3IHW4
LinkDB All DBs
Position
complement(1444046..1445554)
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLASATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKLAPHIAFPMRFRLPHQPHLRPAWMIRIGLFLYDHLGKRTSLPGS
KGLKFGQNSVLKPELNKGFEYSDCWVDDARLVVLNAQEVVRKNGEVRTRTKVTRAYREDG
LWVVEAEDLRTGEKETWKAKGLVNATGPWVKEFFDDGLKLKSPYGIRLIKGSHIVVPRAH
DEPQAYILQNEDNRIVFVIPWMDEFSIIGTTDVEYKGDPKNVRIDDNEVNYLLKVYNDHF
KKQLSKADIVWDYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKLTTYRK
LAEAAVGKLAPYYPNAGAAWTKNGVLPGGDIEGCDRDGYARLLRQRYNWLPEGLALRFAR
TYGSQSKLILEGANSLSDLGEAFGHNVYEAELRYLVEHEWVTELDDAIWRRTKLGMWLNE
SEKQRIAQWLAEHVNVAQPATV
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggaaactaaagacttgattgtaatcggcggcggtataaacggcgctggtatcgcggca
gatgccgctggccgtggattatctgtattgctgcttgaagctcaagacttagcaagtgcg
acatcatctgcgagttcaaaactgatccacggtggtttacgttatcttgagcattatgaa
tttcgccttgtgagtgaagcacttgctgaacgcgaggtgttattaaaacttgcgccacac
attgcgtttccaatgcgcttccgtctgccgcaccaacctcacttacgcccagcttggatg
atccgtattggcttgttcctgtatgatcacttgggtaaacgtaccagcttgcccggcagt
aaagggttaaaatttggtcaaaattccgtccttaagcctgaacttaacaaaggtttcgaa
tattcagactgttgggtcgatgatgcgcgtttggttgtattaaacgctcaagaagtggta
cgtaaaaatggtgaggttcgcacacgtacaaaagtcactcgagcctatcgtgaagatggc
ttatgggtagttgaagcagaagacctgcgcactggtgaaaaagaaacttggaaggcgaaa
ggtttagttaacgctactggcccatgggtaaaagagttctttgacgatggtttgaaactc
aaatcaccttatggcattcgtcttatcaaaggtagccatattgttgtgcctcgcgctcat
gatgagccacaagcttatattttacaaaatgaagacaaccgtattgtgtttgtgatccct
tggatggatgaattttccattatcggcaccaccgatgtcgaatacaaaggcgatccaaaa
aatgttcgtattgatgacaatgaagtgaactacttactaaaagtctataacgatcatttc
aaaaaacagttgagcaaagcggatattgtttgggattactcaggggttcgtccattatgt
gacgatgagtctgattcaccacaagccattacacgtgactacacactcgatattcacgat
gaaaatggcaaagcaccgctgctgtctgttttcggcggtaaattaaccacttatcgtaaa
ctcgcagaagcggctgtcggtaaacttgcgccttactacccaaatgcaggtgcagcatgg
actaaaaatggtgtgctgcctggcggtgacattgaaggttgtgatcgtgatggttatgca
cgcttactacgtcaacgttacaattggctaccagaagggcttgctctacgttttgcaaga
acatacggtagtcaaagcaagttgatcctcgaaggcgctaactcactcagcgatcttggc
gaagcattcggtcataacgtctatgaagcagagctacgttacttagtcgaacatgagtgg
gttactgaattagatgacgctatctggcgtcgtaccaaattgggcatgtggctgaacgaa
agtgaaaaacagcgcatcgcacaatggttggcagagcatgtgaacgtcgctcaaccagcc
acagtttag

DBGET integrated database retrieval system