KEGG   Providencia stuartii ATCC 33672: DR96_280Help
Entry
DR96_280          CDS       T03282                                 

Gene name
fabZ
Definition
(GenBank) beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
psx  Providencia stuartii ATCC 33672
Pathway
psx00061  Fatty acid biosynthesis
psx00780  Biotin metabolism
psx01100  Metabolic pathways
psx01212  Fatty acid metabolism
Module
psx_M00083  Fatty acid biosynthesis, elongation
psx_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:psx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DR96_280 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    DR96_280 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:psx01004]
    DR96_280 (fabZ)
Enzymes [BR:psx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     DR96_280 (fabZ)
Lipid biosynthesis proteins [BR:psx01004]
 Fatty acid synthase
  Component type
   DR96_280 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA PS-DH 4HBT MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: AIN64727
UniProt: A0A1L3IKV4
LinkDB All DBs
Position
complement(315818..316270)
Genome map
AA seq 150 aa AA seqDB search
MSDNHTLNIEEILELLPHRYPFLLVDRVLDFEKGKSLRAVKNVSFNEPFFQGHFPGKPIF
PGVLILEAMAQATGILAFKSVGKLEPGELYYFAAIDNARFKRPVLPGDQMILEVEFIKER
RGVARFKGVAKVDGEVACEAEMMCARRREV
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgagtgataatcatactctgaatattgaagagattttagaattacttccacaccgttac
ccattccttttggttgaccgtgtactggattttgaaaaaggaaaatctctgcgcgcagta
aaaaatgtgtcattcaatgaaccctttttccaaggccactttccgggcaaacctattttt
ccaggtgtgttgatcctagaagcaatggctcaagcaacaggtatcctagcatttaagagc
gttggtaaactagaaccgggtgaattgtactattttgcagcgattgataatgctcgtttc
aagcgcccagtgttgccgggagatcagatgatcctcgaagtcgagtttattaaagaacgt
cgcggtgttgcacgttttaaaggtgttgcaaaagttgatggagaagtggcctgcgaagct
gaaatgatgtgcgcccgtcgccgtgaggtctga

DBGET integrated database retrieval system