KEGG   Providencia stuartii ATCC 33672: DR96_3026Help
Entry
DR96_3026         CDS       T03282                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
psx  Providencia stuartii ATCC 33672
Brite
KEGG Orthology (KO) [BR:psx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DR96_3026 (ahpF)
Enzymes [BR:psx01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DR96_3026 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 FAD_binding_3 AlaDh_PNT_C NAD_binding_8 Thi4 DAO FAD_oxidored Glutaredoxin NAD_binding_7 K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: AIN63125
UniProt: A0A379GPA3
LinkDB All DBs
Position
3285092..3286666
Genome map
AA seq 524 aa AA seqDB search
MLDNNMQAQLKAYLEKLTKPVELVANLDSSNKSNEIKQLLNQIAALSDKITVREVQDNTQ
RVPSFLITNPGVDSGLRFAGSPLGHEFTSLVLALLQIGGHPSKEAQELLDQVKALEGEFH
FETYYSLSCHNCPDVVQALNLMAVLNPNVTHTAIDGALFQNEIEERNVMGVPAVFLNGKE
FGQGRMTLSEIINKVDTNADARAAKALTEREPFEVLIIGSGPAGASAAVYTARKGIRTGV
IGERFGGQVMDTVDIENYISVLKTEGAIFAGALKNHVDDYNVDVIDGQSVTKLIPATEEG
GYHQIETASGGVMKSRSIIIATGARWRNMGVPGEQEYRTKGVTFCPHCDGPLFKGKRVAV
IGGGNSGIEAAIDLAGIVEHVTVLEFAPELKADSVLQDKARSLKNVDIIVNAQTLEVKGD
GSKMTGLEYKDRTDDSVHLLEVAGAFVQIGLLPNTNWLGDTVARNRIGEIEVDARGETNV
KGVFAAGDCTTVPYKQIIISAGEGAKAALSAFDYLIRTSTRTAE
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgctcgataacaatatgcaagcgcaattgaaagcgtatttagaaaaattgactaaacct
gttgagttagtcgctaatttagatagcagtaataaatcaaatgaaataaaacagcttcta
aaccaaattgctgcgctttcagacaagattactgttcgtgaagtacaagataatactcaa
agagtaccatcatttttaattactaaccctggtgttgatagtggattgcgttttgcaggt
tcaccactaggccatgaatttacatcgcttgtgcttgcattgttgcaaattggtggtcac
ccatctaaagaagcacaagagttattagatcaagtgaaggcccttgaaggggaattccat
tttgaaacctattattcattatcgtgccataactgcccagatgttgtgcaagcactgaat
ttaatggcagtattaaatccaaatgtcacacatacagcgattgatggtgcgctgtttcaa
aatgaaattgaagaacgtaatgtgatgggcgttcccgctgttttcttaaatggaaaagag
ttcggccaagggcgcatgacattaagtgagatcattaataaggttgacacgaatgctgac
gcgcgtgccgctaaagcattaacggaacgtgaaccatttgaagtactcatcatcggtagt
ggacctgctggagcatccgcagcggtttatactgcacgtaaaggtattcgcactggtgtg
atcggtgagcgttttggtggccaagttatggataccgttgatatcgaaaactacatttct
gtactcaaaacagaaggggcgatatttgcgggagcactgaagaaccacgttgatgactac
aatgttgatgtaattgatggtcagtcagtgactaagttaattccagcaacagaagaaggc
ggttaccaccaaatcgaaacagcttccggcggagtaatgaagtcacggagtatcattatt
gcgacaggtgcccgttggcgtaacatgggagtacctggggagcaagagtatcgcacgaaa
ggcgttacattctgcccacactgtgatggtccgttgtttaaaggcaaacgcgttgctgtg
attggtggaggtaactcaggtattgaagcggctattgacttagcgggtattgttgaacat
gtaacagtattggaattcgcgcctgaattgaaggcggattcagtactacaagataaagca
cgtagcctgaaaaatgttgacattatcgttaatgctcaaacattggaagtgaagggcgat
ggtagcaagatgacgggtcttgaatataaagaccgtactgatgatagtgtacatttatta
gaagttgcaggcgcatttgtgcaaattggcctgttgccaaataccaattggttaggtgat
accgttgcacgtaaccgtataggcgaaattgaggtggatgcacgtggcgaaacaaatgtg
aaaggtgtgttcgctgcgggtgactgtactactgtaccttataaacagatcattatttca
gccggtgaaggtgcaaaagccgcacttagcgcatttgactacctaatccgcacaagtacc
agaaccgctgaataa

DBGET integrated database retrieval system