KEGG   Providencia stuartii ATCC 33672: DR96_3044Help
Entry
DR96_3044         CDS       T03282                                 

Gene name
accA
Definition
(GenBank) acetyl-CoA carboxylase, carboxyl transferase, alpha subunit
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Organism
psx  Providencia stuartii ATCC 33672
Pathway
psx00061  Fatty acid biosynthesis
psx00620  Pyruvate metabolism
psx00640  Propanoate metabolism
psx01100  Metabolic pathways
psx01110  Biosynthesis of secondary metabolites
psx01120  Microbial metabolism in diverse environments
psx01130  Biosynthesis of antibiotics
psx01200  Carbon metabolism
psx01212  Fatty acid metabolism
Module
psx_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:psx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DR96_3044 (accA)
   00640 Propanoate metabolism
    DR96_3044 (accA)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DR96_3044 (accA)
Enzymes [BR:psx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     DR96_3044 (accA)
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     DR96_3044 (accA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACCA Carboxyl_trans MdcE Acyl-CoA_dh_N
Motif
Other DBs
NCBI-ProteinID: AIN64934
LinkDB All DBs
Position
3301250..3302209
Genome map
AA seq 319 aa AA seqDB search
MSTHFLAFEKPIVELNERIDALVAFKQNSQQPDIDFDEEIKLLEKKCLALTKKIFSQLGA
WEIVQLARHPLRPYTLDYISLIFTEFQELAGDRAFADDKALVGGLARLDGQPVMVIGQQK
GRTTKEKVMRNFGMPSPEGYRKALRLMKMAERFHLPVVIFIDSAGAYPGIGAEERGQAEA
IARNIMEMSCLKTPIICVITGEGCSGGALAIGVGDRINMLEYSTYAAISPEGCASILWKD
AQKAQVAAETMGMTAKRLKELGIIDTIIPEPLGGAHRDYVLASENLKRQLLIDLEALKKR
DVDLLLAERYQKIMAFGYC
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtctactcacttcttagcatttgaaaaacctatcgtcgaacttaatgaaagaatcgac
gccttagtggcttttaaacaaaatagccaacagcctgatattgatttcgatgaagagatc
aagttgctggagaaaaaatgtttagcactgacaaagaaaattttttctcagcttggtgct
tgggaaatagttcaacttgcaaggcatccattgaggccctataccctagattatatttcg
ctgatttttacggaatttcaggagttggctggagatagggcatttgcggatgataaggcg
cttgttggtggtctagcacgccttgacgggcaacctgttatggttataggtcaacagaaa
gggcgtaccacaaaagaaaaagtgatgagaaatttcggtatgccttccccggaaggttac
cgtaaggcattaaggttaatgaagatggctgagcgttttcatttacctgtggtgatattc
attgattctgcgggggcatatcccggtattggtgcagaagagagagggcaagctgaagcg
atagcacgaaatattatggagatgtcttgcctaaaaacacctatcatttgcgtgataaca
ggggaaggttgctctggtggtgcactggcaataggggttggcgaccgtattaatatgttg
gagtacagcacatatgcggcaatatcaccggaaggttgtgcttcaatcctttggaaagat
gcacaaaaagcgcaagttgctgcggaaacaatgggaatgacagccaaaaggctcaaggag
ctaggtattattgacactattatccctgaaccgctcggtggcgcacatcgcgattatgta
ttagcgagtgaaaatttaaaacggcagttgcttattgatttagaggccctcaaaaaacgg
gatgttgatctattattggccgaaagatatcagaaaattatggcgtttggttactgttaa

DBGET integrated database retrieval system