KEGG   Providencia stuartii ATCC 33672: DR96_3239Help
Entry
DR96_3239         CDS       T03282                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase Cu-Zn
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
psx  Providencia stuartii ATCC 33672
Brite
Enzymes [BR:psx01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     DR96_3239 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AIN63008
UniProt: A0A379H3G3
LinkDB All DBs
Position
complement(3500996..3501520)
Genome map
AA seq 174 aa AA seqDB search
MKFKMCLLAGLLTAFAANAAETTVVLKEATPQGEGKAIGEVVISETDYGLLFTPKLAGLE
AGIHGFHIHENPSCEPAEKDGKSVPALKAGGHMDPAKTGVHKGPYDNTGHLGDLPGLVVD
AKGNADYAVLAPRLKTLKEIENRALMVHAGGDNYSDHPEALGGGGARMACGVIK
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcaaaatgtgtttactggccggcttattaacggcttttgcagcaaatgcagca
gaaacaacagtagtactgaaagaagctacaccacaaggtgaaggcaaggcgattggtgaa
gttgttatttctgaaaccgattatggattattgtttaccccaaaattagcaggtttagaa
gcgggtatccatggtttccatatccatgaaaacccaagctgtgagcctgctgaaaaagat
ggcaaatcagtaccagcattaaaagcaggtggacatatggatccggcaaaaacaggtgtc
cataaagggccttatgacaatacaggccacttaggggatcttccgggtttagtggttgat
gccaaaggtaatgccgattatgcagtattagcaccgcgcttaaaaacactaaaagagatt
gaaaaccgtgcactgatggtacacgcgggtggggataattactccgaccatcctgaagcg
ttaggtggtggtggtgcacgcatggcttgtggtgtgatcaaatag

DBGET integrated database retrieval system