KEGG   Providencia stuartii ATCC 33672: DR96_3338Help
Entry
DR96_3338         CDS       T03282                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
psx  Providencia stuartii ATCC 33672
Pathway
psx00473  D-Alanine metabolism
psx01100  Metabolic pathways
psx01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:psx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DR96_3338 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    DR96_3338 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:psx01011]
    DR96_3338 (alr)
Enzymes [BR:psx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     DR96_3338 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:psx01011]
 Precursor biosynthesis
  Racemase
   DR96_3338 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Arteri_nsp7a GAD
Motif
Other DBs
NCBI-ProteinID: AIN62478
LinkDB All DBs
Position
complement(3600167..3601390)
Genome map
AA seq 407 aa AA seqDB search
MSFRLRYLALLPLLVATACQQPANTNTKAIPDAQIQPIIVNNSWIEISRSALDFNIKKVQ
ALLGDKSSLCAVLKGDAYGHDLTLVTPLMIENNVQCIGLTNNQEFKQVRELGFKGRLMRV
RNATEQEMAQATAYDVEELIGNLDMAQRLNDIGKKQNKVIPIHLALNSAGMSRNGLEVSH
AQGLNDAKMIAQLPQLKVVGIMSHYPEEDEAQIRKDLAKFKKQSQQVLDVTGLKREDVIL
HVANTYATITVPESWLDMVRVGGIFYGDTVATKDYKRVMTLKSNIASVNHYPKGNTVGYD
RTYTLKRDSVLANIPVGYADGYRRVFSNAGHALINGQTVPVLGKTSMNTVMVDVTDLKQV
QPGDEVVFFGKQGNGEITAEEVEDISGALFTEMSILWGATNKRILVD
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttcggttgagatatcttgctttacttcctctattggtcgcaacagcttgccag
caacctgcaaacaccaacaccaaagcgatccctgacgcacaaatccaacccattattgtg
aataattcttggatagaaatttctcgtagtgcactcgatttcaatattaaaaaagtgcag
gcgttgctgggggataagtcatcgctttgtgctgtattgaaaggggatgcgtatggtcat
gatttgacgctggtaacgcctctgatgattgaaaataatgtgcaatgtattggcttaaca
aataatcaagaatttaaacaagtcagagagttaggtttcaaaggccgtttgatgagagtg
cgtaatgccactgaacaagaaatggcacaagcaacagcctatgacgttgaagagcttatc
ggtaatctcgatatggcacagcgtttaaatgatattggtaaaaagcaaaataaagtaata
ccaatccatttagcgttgaattcagcgggaatgtcacgtaatgggctagaagtgagtcat
gcgcaaggcctcaatgacgcaaaaatgattgctcaattacctcagctaaaagttgttggc
atcatgtcgcattatcctgaagaagatgaggctcaaatccgcaaagatttagcgaagttt
aaaaagcagtcacaacaagtccttgatgtaactggattgaagcgtgaagatgtcattttg
catgtggcgaatacctatgcaaccatcactgtacctgagtcatggcttgatatggtgcgt
gttggcggtattttctatggtgacacggtagcaacgaaagactataagcgtgtcatgaca
ttaaaatcgaatattgcctcggtgaatcattaccctaaaggaaacacggtcggttatgac
agaacctatacgctaaaacgtgactctgtattggctaatattcctgtcggttatgctgac
ggctaccgccgagtattcagtaatgcggggcacgcattaattaatgggcagacggtgcct
gtattaggaaaaacatcaatgaataccgtgatggtcgatgtgactgacttaaagcaagtc
caacccggagatgaagttgttttctttggtaaacaaggtaatggtgaaatcactgccgaa
gaggttgaagatatcagtggagcattatttactgaaatgtcaattctttggggagcgacc
aacaaacgtattcttgtcgattaa

DBGET integrated database retrieval system