KEGG   Providencia stuartii ATCC 33672: DR96_3644Help
Entry
DR96_3644         CDS       T03282                                 

Definition
(GenBank) hypothetical protein
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
psx  Providencia stuartii ATCC 33672
Pathway
psx00220  Arginine biosynthesis
psx00250  Alanine, aspartate and glutamate metabolism
psx00290  Valine, leucine and isoleucine biosynthesis
psx01100  Metabolic pathways
psx01110  Biosynthesis of secondary metabolites
psx01130  Biosynthesis of antibiotics
psx01210  2-Oxocarboxylic acid metabolism
psx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:psx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DR96_3644
   00290 Valine, leucine and isoleucine biosynthesis
    DR96_3644
   00220 Arginine biosynthesis
    DR96_3644
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:psx01007]
    DR96_3644
Enzymes [BR:psx01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     DR96_3644
    2.6.1.66  valine---pyruvate transaminase
     DR96_3644
Amino acid related enzymes [BR:psx01007]
 Aminotransferase (transaminase)
  Class I
   DR96_3644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Aminotran_MocR Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AIN65456
UniProt: A0A379GL43
LinkDB All DBs
Position
3918918..3920132
Genome map
AA seq 404 aa AA seqDB search
MNNIKKSNKLDNVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFEAPDEILVDVLR
NLPSSQGYCDSKGLYSARKAIVQHYQARNIREMTVEDVYIGNGVSELIVQAMQALLNNGD
EMLVPAPDYPLWTAAVSLSGGNAVHYMCDEQQGWMPDIDDIRKKVTPRTRGIVIINPNNP
TGAVYSKELLLEIVELARQHNLIIFADEIYDKILYDGAVHHSIAALAPDLLTVTFNGLSK
TYRVAGFRQGWMVLNGPKQQAKSYIEGLEMLASMRLCANVPMQHAIQTALGGYQSISEFI
QPGGRLYEQRERAWQLINQIPGVSCVKPQGALYMFPKIDIKRFNIHDDQKMILDLLLQEK
VLLVQGTAFNWPEPDHFRIVTLPYADDLEMAINKFGRFIENYRQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaataacattaaaaaatctaacaagcttgataatgtctgttacgacattcgcgggcct
gtattaaaagaagcaaagcgcttagaagaagaaggtaacaaagtcctcaagctaaatatc
ggtaatccggcaccgtttggcttcgaagccccagatgaaattctggtcgatgtattgcgt
aatctaccgagctcgcaaggttattgtgattcaaaaggattatattccgcacgtaaagcc
attgttcagcactatcaggctcgcaatattcgtgaaatgacggttgaagacgtttatatt
ggtaatggtgtttctgaactgattgtgcaagcaatgcaagcgctgctcaataatggtgat
gagatgctagtacctgcccctgattacccgttgtggactgcggcagtttctttatccggt
ggtaatgcagttcattatatgtgtgatgaacagcaaggttggatgcctgatattgatgat
attcgtaaaaaagttacgcctcgcactcgcggaattgtcatcattaacccaaataaccca
accggcgcggtttacagtaaagagttattgttagaaatcgttgagcttgcacgccaacac
aaccttattatttttgccgatgagatttatgataaaatcctgtatgacggtgccgtgcat
cactcaattgcggcattagcgccagatttactgaccgtcacttttaacggattgtcaaaa
acctatcgtgtggcaggtttccgccaaggttggatggtattaaacgggccgaaacaacaa
gctaagagctatattgaaggtctcgaaatgttagcatcaatgcgcctgtgtgctaacgtt
cctatgcagcatgctatccaaacagcactcggcggctatcaaagcatcagcgaatttatt
caacccggtggtaggttatatgagcaacgtgaacgtgcttggcaactaattaaccaaatc
ccaggggtttcttgtgtaaaaccacaaggcgcgctgtatatgttccctaaaatcgatatt
aagcgtttcaatatccatgatgaccagaaaatgatccttgatttattactacaagaaaaa
gtgcttcttgtacaaggtactgcatttaactggccagagccggatcacttccgcatcgtg
accctgccttatgcagatgatcttgaaatggcaattaataaatttggtcgttttatcgaa
aattatcgccaataa

DBGET integrated database retrieval system