KEGG   Providencia stuartii ATCC 33672: DR96_3867Help
Entry
DR96_3867         CDS       T03282                                 

Definition
(GenBank) surface antigen repeat family protein
Organism
psx  Providencia stuartii ATCC 33672
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TSC22 FKBP_C
Motif
Other DBs
NCBI-ProteinID: AIN62415
LinkDB All DBs
Position
complement(4154436..4158074)
Genome map
AA seq 1212 aa AA seqDB search
MRINLRLCISLAIFSAAFSQFAKSDSFNNVIDDFDTYLQLEQEGKVPEKPLNIQGQGYDS
FSSLPLAPEPKEKSKSAAGKNAGQSKTPARTQPKAKGAVTQQTQTKVTTTKVATQAKGQM
TEQPKVALSECPLPEESIVDQQTGSAHQSLLLSSYPYFFNSNQWHPQYLSKDFAKYQIVL
DPLGLYSAKYSMGVLRDNTAYLEQLADLLAQQQSTHLFRFGAAQGAGQLIAYHQLLTDRQ
LVEKLIAHNKSVAELSHDIAEKQFEIERINNELAENKNQVALLREKLSATDDKETIVLLT
DELNSVKNILADKENNLEQLTAQNQQAQKSIAALEKKLSESIQAQALAEKQLAEKDKQIE
QAKLQFENAQKQVEQLTAQLTQLETDAKEQAERLNKNSDEQVKLVTASLEKQKELLKQKE
SELQLTQKQNSDIQAELLKQQAASKAFEAELKAAQQLLKTNKTEQDSLTKQYAESLKIQQ
QLQEKLAKQEQEFATAQTQLKKANTDVVELQKEIEKQKQLMTQASDQQVKALTADLNQQI
ALLKKQEAVLQKAESDSQATREALAKQQATAQQLVEQKKALEAELKTAQAQLQAQKTEQA
TLAKQYEAGQKAQQQLQEKLAKQEQEFATAQTQLKKANTDVVELQKEIEKQKQLMTQASD
QQVKALTADLNQQIALLKKQEAVLQKAESDSQATREALAKQQAAAKQLAEQNKQLQAQLK
DNEQQAAKLQASLTAQTAQAEQKKALEAELKAAQAQLQAQKTEQTALAKQYEAGQKAQQQ
LQEKLAKQEQEFATAQAQLKKANTDVVELQKEIEKQKQLMTQASDQQVKALTADLNQQIA
LLKKQEAVLQKAESDSQATREALAKQQAVAKQLAEQNKQLQAQLKDNEQQAAKLQTVLTA
QTAQTEQHKALEAELKAAQKQLQAQKAEVEKQAKEREQQIKRLETDITTKEKKAADIDKQ
LVEANKQISALKLDAEKLKGIDNKYQSQNTELEKLKKQLADSANLQKELATAKDQLKKLE
AELKQQMSLTSNEALKAQIMELNKKVMQLQDENDKLKAKIAPSGSTSIMGAPKKQLSQKE
LKAIAQANAKRNQRIIEEITKQKYSKLDSFTYYKILQKGKPITNVQKKNITFIMREQLTD
GTLTVLYKDQEPVTLPYSELPAPLNSFVEKAGEGGMVKVYIKPEGGYGVDGIPGVIPPNS
MSIIDLKIISAK
NT seq 3639 nt NT seq  +upstreamnt  +downstreamnt
atgagaattaacctaagactttgtatatctttggccattttttcggctgcttttagtcaa
tttgcaaaatcggatagcttcaataatgtcattgatgactttgacacttacctgcaatta
gagcaggaaggtaaagtgccggaaaagccattgaatattcaaggtcagggatatgactca
ttttcatctttaccgctcgctcctgagccaaaagaaaaatctaaatctgctgcgggtaaa
aatgcaggccaaagtaaaacgcctgcacgtacccaacctaaagctaaaggggcggtcact
cagcagacccagactaaagttacgacgacaaaagtagctacacaagctaaaggtcagatg
acagaacaacctaaagttgctttgtctgaatgcccattaccagaagaaagcattgtggat
caacaaactggttcagcacaccagtctttgttattgtcatcctacccttatttctttaat
tcaaaccaatggcatccacagtatttatcgaaagattttgctaaataccaaattgttcta
gatccattagggctttactctgctaagtactcaatgggggtattgcgtgataatacggct
tacctagaacagcttgccgatctactcgcgcaacaacaatcgactcacctatttagattt
ggtgctgctcaaggcgctggtcagttaattgcttatcatcaacttttaaccgataggcaa
ttagtcgaaaaattaattgcacataataaaagtgtagcggaactcagtcatgatatcgcc
gagaaacaatttgaaatagagcgtatcaataacgaacttgccgaaaataaaaatcaagtt
gctttgttacgtgaaaaactaagtgcaacagatgataaagaaaccattgtattactgacg
gatgaattgaactccgttaaaaatatactggcagataaagaaaataatttagaacaactc
actgcacagaatcaacaagcgcagaaatcaattgcggcacttgagaaaaaacttagcgaa
agtattcaagctcaagcattagcagaaaaacaacttgctgagaaagataaacaaatagag
caagcaaaattacaatttgaaaatgctcagaagcaagttgaacaattaaccgcccagcta
actcaattagaaacggatgcaaaagagcaggcggaacgattaaataaaaatagtgacgag
caagttaagctcgtgactgcttcacttgaaaaacagaaggaattactgaagcaaaaagag
tcagaacttcagttaactcaaaaacaaaatagcgatattcaagctgaactgttgaaacag
caagcagcttctaaagcttttgaggctgagctaaaagcggcacaacaactgttaaaaacg
aataaaacagagcaagattcgctgacgaaacagtatgcagaaagtctgaaaattcagcag
cagctacaagaaaaattagcgaaacaagagcaagagtttgcaacagcacaaactcagctg
aaaaaagccaatacggatgttgttgagctgcaaaaagagattgagaagcagaagcagcta
atgacgcaagcgtcggatcagcaagtaaaagcattgacggctgatcttaaccaacaaatt
gcgttattgaagaaacaagaagcggtgttgcaaaaagcggagtcagatagccaagcgaca
cgcgaagcgttggcgaagcaacaggccacagcgcaacagttagtagagcagaaaaaagcg
ttagaagctgagttgaagacagctcaagcacagttacaagcacagaaaacggagcaagcg
acattagcgaagcaatatgaagcaggtcagaaagcccagcagcagctacaagaaaaatta
gcgaaacaagagcaggagtttgcaacagcgcaaactcagctgaaaaaagccaatacggat
gttgttgagctgcaaaaagagatagagaagcagaagcagctaatgacgcaagcgtcggat
cagcaagtaaaagcattaacggctgatcttaaccaacaaatcgcgttattgaagaaacaa
gaagcagtgttgcaaaaagcggaatcggatagccaagcgacacgcgaagcgctggcgaag
caacaggccgcagcgaaacagttagctgagcagaataagcagctacaagcgcagttaaaa
gataacgagcagcaggccgcgaaactgcaagcctcgttaacggctcaaacggcacaagcg
gagcagaaaaaagcgttagaagctgaattgaaggcggctcaagcacagttacaagcacag
aaaacggagcaaacggcattagcgaagcaatatgaagcaggtcagaaagcccagcagcag
ctacaagaaaaattagcgaaacaagagcaggagtttgcaacagcgcaagctcagctgaaa
aaagccaatacggatgttgttgagctgcaaaaagagatagagaagcagaagcagctaatg
acgcaagcgtcggatcagcaagtaaaagcattaacggctgatcttaaccaacaaatcgcg
ttattgaagaaacaagaagcggtgttgcaaaaagcggaatcggatagccaagcgacacgc
gaagcgctggcgaagcaacaggccgtagcgaaacagttagccgagcagaataagcagcta
caagcgcagttaaaagataacgagcagcaggccgcgaaactgcaaaccgtgttgacggca
caaaccgcgcagactgagcaacataaagcattagaagctgaattgaaagctgctcaaaaa
cagttacaagcacaaaaagcggaagttgaaaaacaagctaaagagcgtgagcaacaaatt
aaacgccttgaaactgatattacgactaaagagaaaaaagcggctgatattgataaacag
ttagtcgaggcgaacaaacaaatcagtgcattaaaactggatgctgagaagctaaaagga
attgataataaatatcaatctcagaatactgagttagaaaaactgaaaaaacagttagct
gacagtgctaatttgcaaaaagagttagcaacagctaaagatcaattgaagaaactagaa
gctgaattgaagcagcaaatgtcattaacttcgaatgaagcgcttaaagcccagatcatg
gagttaaataaaaaagtcatgcagcttcaagatgaaaatgacaagttaaaagcgaaaata
gcgccgagtggctctacatcgattatgggagcacctaaaaagcaactgtctcaaaaagag
ctaaaggcaattgctcaagcgaatgcaaagcgtaatcaacgtataattgaggaaatcact
aagcagaaatacagtaagcttgatagctttacgtattataaaatcctgcaaaaaggtaag
ccaattaccaatgtgcagaagaaaaatatcacatttattatgcgagaacagcttactgat
ggaactctgacggtactgtataaggatcaagagcctgtcacattgccttatagtgaacta
cccgcaccgttgaactcctttgttgagaaagcgggtgaagggggtatggttaaggtttat
attaagccagaaggtggttatggtgtcgatggaatacctggggtcattccgccaaactca
atgtcgattattgatttaaaaattatcagcgctaaataa

DBGET integrated database retrieval system