KEGG   Providencia stuartii ATCC 33672: DR96_954Help
Entry
DR96_954          CDS       T03282                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase family protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
psx  Providencia stuartii ATCC 33672
Pathway
psx00620  Pyruvate metabolism
psx00680  Methane metabolism
psx01100  Metabolic pathways
psx01120  Microbial metabolism in diverse environments
psx01200  Carbon metabolism
Module
psx_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:psx00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    DR96_954
  Energy metabolism
   00680 Methane metabolism
    DR96_954
Enzymes [BR:psx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     DR96_954
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AIN65606
LinkDB All DBs
Position
complement(1012076..1014715)
Genome map
AA seq 879 aa AA seqDB search
MNQQYSAMRSNVSMLGKLLGDTIKEALGEDILDKVESIRKLSKSSRAGNEVQRQKLLMTL
QNLSNDELLPVARAFNQFLNLTNVAEQYHSISPHGEAASNPVALKKLFSRLKEKNFTDSD
LRQAVNQLSIELVLTAHPTEIARRTLIHKLVEVNTCLSQLDHDDLADYERNNIMRRLRQL
VAQSWHTDEIRKIRPTPIDEAKWGFAVVENSLWEAVPAFLREFNEQLEDSIGAELPVEAN
PIRFTSWMGGDRDGNPNVTAEVTRHVLLLSRWKAADLFLKDIQVLVSELSMTEATPELRA
FAGGDEVDEPYRQIAKNLRSQLFSTLEYLERKVKGEQALPPADLLTDNAQLWDPLYACYQ
SLMACGMSIIANGQLLDTLRRIRSFGLQLVRIDVRQESTRHTEALAELTQYLGLGDYAAW
SEEEKQAFLLSELQSRRPLIPRHWQPSPETAEVFETCRVIAESKNDSIAAYVISMAKVPS
DVLAVKLLLKEAGASVRLPVAPLFETLEDLNNAESVMQKLLSIEWYRELIDDRQMVMIGY
SDSAKDAGVMAASWAQYRAQDALIKLCDKEGVTLTLFHGRGGTIGRGGAPAHSALLSQPP
GSLKGGLRVTEQGEMIRFKFGLPQVAISSLALYASAILEANLLPPPEPKQEWKSVMDTLS
DVSCAMYRDYVREQPDFVPYFRAATPELELGKLPLGSRPAKRRPTGGVETLRAIPWIFAW
TQNRLMLPAWLGAGAALKYVIEKEGKQAILDEMWQQWPFFNTRIAMLEMVYAKADLWLAE
YYDHRLVEERLWPLGVKLREQLSEDIKSVLAVSKDEALMADLPWIAESIALRNVYTDPLN
VLQAELLHRSRQQEHPDPRVEQALMVTIAGVAAGMRNTG
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagcaatattccgcaatgcgcagtaatgtcagtatgctgggtaagctacttggc
gacacaatcaaggaagcattaggtgaggatatcctcgataaagtcgaatcaattcgtaag
ttgtcaaaatcatcgcgtgcaggcaatgaagtacaacgccaaaagctgttgatgacactg
caaaacctatctaatgatgaactattaccggttgcaagagcatttaaccaatttttgaac
ctgacaaacgttgccgaacaatatcatagcatttcgccacatggtgaagcagcgagtaac
cctgtggcacttaaaaagctgtttagtcgtttaaaagagaaaaactttaccgatagtgat
cttcgtcaagcggttaaccaactgtcgatcgaattggtgctaacggcccatcctactgaa
atcgcacgccgcaccttgatccataaattggttgaagtgaatacctgcttatcacaactc
gatcatgatgatctggctgattacgaacgcaacaatatcatgcgtcgtttacgtcagttg
gtcgctcagtcgtggcacactgacgaaatccgtaaaatacgtccaacgccaattgatgaa
gccaaatggggtttcgccgtagttgaaaactcactttgggaagcggttccggctttccta
cgtgaatttaatgagcaattagaagactcaattggtgctgaactgcctgtcgaagcaaac
ccaattcgttttacttcttggatgggaggagaccgcgacggtaacccgaatgtgactgcg
gaagtgactcgccatgtattactacttagccgctggaaagccgcagatctctttttaaaa
gatatccaggtgttggtttctgaactgtccatgaccgaagcgacacctgagttacgggcg
ttcgctgggggagatgaggtagatgaaccttaccggcaaattgcaaaaaatttgcgtagc
caactcttttccacattagagtatttagaacgcaaggtaaaaggcgaacaagcactacca
ccagccgatttactgaccgacaatgcccaattgtgggatccactatatgcctgttatcaa
tcgttaatggcctgtggtatgagcattattgctaatgggcagttactcgatacgttacgt
cgtatacggagttttggcttgcaactcgttcgcattgacgttcgccaagaaagtactcgc
catacagaagcgcttgctgaattaacgcaatatcttgggttaggagattatgcagcttgg
agtgaagaggaaaaacaagcctttttactgtctgaattacaatctcgtcggccgttgatc
cctcgtcattggcaaccaagccctgagacggcagaagtatttgaaacttgccgcgtgatc
gcagaatcgaaaaatgactccatcgcagcttacgtcatttcgatggcgaaagttccttcc
gatgttctggccgttaaattgctcctcaaagaggcgggggcatccgttcgcctgcctgtc
gcacctctgtttgaaacacttgaagatttgaataatgctgaaagtgttatgcaaaaactc
ttgagcattgagtggtatcgtgagctgattgatgaccgccaaatggtcatgattggctac
tctgattcggcaaaagatgctggggtgatggcggcatcatgggcgcaatatcgtgcacaa
gatgcgctgattaagttgtgcgacaaagaaggggtcactttaaccttgttccatggacgt
ggaggcactattggccgtggtggtgcgcccgctcattcagcactcttgtcacaaccgccg
ggcagcctgaaagggggattacgtgtgactgaacaaggtgaaatgatccgctttaagttt
ggtctaccacaagtggcgattagcagccttgcgctgtatgcaagcgcgattttagaagct
aatttactgccgccaccggagccaaaacaagagtggaaatcagtgatggataccctctct
gacgtttcttgtgcgatgtaccgtgattatgttcgtgagcagcctgattttgtaccttac
ttccgcgctgcaacaccagagctagaattaggcaagttgccgttggggtctcgtccggca
aaacgccgtccaacggggggcgttgagacattacgtgcgatcccatggatttttgcatgg
acacaaaatcgcctcatgttgcctgcttggttaggggcgggagcagcgttaaaatatgtg
attgagaaagaaggcaaacaagccatattagatgaaatgtggcaacaatggccgttcttt
aatacccgtatcgccatgctggaaatggtttatgcgaaggctgacttgtggctggctgaa
tattatgatcaccgtttagtggaggagcgcctttggcctctgggtgtgaaattacgtgag
cagctctctgaagatattaagagtgtgctggcggtgtccaaagatgaagccttaatggct
gacttaccttggattgcggagtcaattgctttacgtaatgtttatacggacccgttaaac
gttttacaggccgagctactacaccgttctcgccagcaagagcatccggatcctcgcgtt
gagcaagcgttgatggtgacgattgcaggtgttgcagcggggatgcgtaataccggctag

DBGET integrated database retrieval system