KEGG   Psychromonas sp. CNPT3: PCNPT3_01670Help
Entry
PCNPT3_01670      CDS       T02515                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
psy  Psychromonas sp. CNPT3
Pathway
psy00620  Pyruvate metabolism
psy00680  Methane metabolism
psy01100  Metabolic pathways
psy01120  Microbial metabolism in diverse environments
psy01200  Carbon metabolism
Module
psy_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:psy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PCNPT3_01670
  09102 Energy metabolism
   00680 Methane metabolism
    PCNPT3_01670
Enzymes [BR:psy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PCNPT3_01670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AGH80276
UniProt: M4U3U3
LinkDB All DBs
Position
complement(386052..388685)
Genome map
AA seq 877 aa AA seqDB search
MTEQYANLRGNVNLLGQLLGKSIGEHLGEEFLDKIEEIRQLSKSSRAGNESDGETLIRVL
SNLSDDELVPVSRAFTHFLNLANIAEQFHCISRHTENSQDAPDPINEVINKLKNSNVSKE
EMQKAINNLSMNMVLTAHPTEITRRTLIHKHTAINECLSLLEVSDVSNKERDQLLDRLEQ
LITQAWHTNDIRKKRPTPVDEAKWGFAVIENSLWEAVPLYVRELDEKLKTELDLCLPEDS
SPINITSWMGGDRDGNPFVTAKVTEEVLITSRWVAINLYLKDIKQLTEELSMDNCDATLR
NIVGDADEPYRAILRKLRIELKETLTALSAKLQGQTSDAKDLITRTEQLKTPIKLCYESL
KKCGMHSIANGLILDILRRVACFGVNLVKLDIRQDGERHGDTLSELTTYLGLGDYNTWTE
PQKQEFLLEELKSKRPLIPSKWKPSAEAQEVLDTCHVIAKTDPQALGIYIISMARQASDV
LSVQLLLKETGCPFKIAVAPLFETLDDLNNAKEVMQRLFAVDWYRNYINGEQHVMIGYSD
SAKDAGVIAANWAQYQAQEALVKICDDNNIQLVLFHGRGGTIGRGGAPAHQALLSQPPGS
LKGGLRVTEQGEMIRFKFGLPKIAIQSLNLYTAAILEANLLPPPAPKQEWRDIMDQFAEQ
SCREYRHFVCDEPDFVPYFRSVTPELELGKLALGSRPAKRKANGGIESLRAIPWIFAWSQ
NRLMLPAWLGTGGSLKTLLDEGKKELLQEMYCNWPFFHTRLEMLEMLFLKTDAGLTKFYE
ERLVPKSLWPLGQRLRDNLSLTREVLLETIPEHKLMQEQPWIKESISLRNPYVDPLNMLQ
AELLSRSRANGDEICPVIDQALMVTIAGIAAGLRNTG
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgacagagcaatatgcaaatttacgtggtaatgtaaatttattaggtcaattactcgga
aaaagtattggcgagcatttgggtgaagagttccttgataaaatagaagaaattcgccag
ctatctaaatcttcacgtgcaggtaatgaaagtgatggagaaacgcttattcgcgtttta
tctaacctctctgatgatgaattagtccccgtttctcgcgcatttacgcactttttaaac
ttggcaaatattgcagagcaatttcattgtatctctcgacatactgaaaatagccaagat
gcccctgacccaatcaatgaagtgattaataagcttaaaaattctaatgtatctaaagaa
gagatgcaaaaagcgattaataacttatctatgaatatggtgttaaccgcacatcccaca
gaaataacgcgacgcacattgatccacaaacataccgcaatcaacgaatgccttagccta
ttagaagtttctgatgtctctaataaagaacgagatcaactactcgatcgcctagaacaa
ctgatcactcaagcttggcataccaatgatattcgcaaaaaacgccctactcctgtcgat
gaagctaaatggggttttgccgtgatcgagaacagtctctgggaagcggttcctctttat
gttcgcgagttagatgaaaaattaaaaactgaacttgatctttgcttaccagaagacagt
tcacctattaatattacctcatggatgggtggagatagagatggtaacccttttgttaca
gccaaagtgaccgaagaagtattaataacgagtcgatgggttgctattaacttatattta
aaagatattaaacagttaaccgaagaattatccatggataattgcgacgccacgctacgc
aatattgtcggcgatgcagatgagccgtatcgcgctattttacgaaaattgcgcattgaa
ttaaaagaaacgctgaccgcattaagcgctaaattacaaggccagacaagtgatgcgaaa
gatttgatcactcgtactgagcaattaaaaacgccaatcaaactttgttatgaatcactt
aaaaagtgtggcatgcactccattgctaatggtttgattttagatattcttcgccgtgtt
gcttgctttggcgttaacctcgttaaattagatattcgccaagatggtgaacgccatggt
gatacgctatctgaattaacaacctatttaggtttaggtgattacaacacttggacagag
ccacaaaaacaagaatttttattagaagagctcaaaagtaaacgccctcttattccgagc
aaatggaaaccctctgctgaagcacaagaagtacttgatacttgtcacgtcattgccaaa
acagatcctcaagcattaggtatttacattatatcgatggcgcgccaagcctcagatgtt
ttatctgtacaactgcttttaaaagagacgggttgtccatttaaaattgcagtggcccct
ctttttgaaacgctagatgacttaaacaacgccaaagaagtgatgcaacgtttgtttgcg
gttgattggtatagaaattatattaacggtgagcaacatgtcatgattggttattctgat
tcggcaaaagatgctggcgttatcgcggctaactgggcgcaatatcaagcgcaagaagcg
ttagttaaaatttgtgatgataacaatattcaacttgttcttttccacggacgtggaggc
acaattggacgtggtggtgctccagcacaccaagcattgctttcacaacctccaggctca
ttaaaaggaggcctgcgagtaacagagcaaggcgagatgatccgctttaaatttggcctg
cctaaaatcgcaatacaaagcttaaacctttacaccgcggctattttagaagccaattta
ttaccaccgccagcgccgaaacaagagtggcgagatattatggatcaatttgcagaacaa
tcttgtcgagaataccgtcactttgtttgtgatgagcctgactttgttccttatttccgt
agcgttacacctgaattagaactcggtaaattagcattaggaagtcgtcctgcaaaacgt
aaagcaaatggtggcatcgaaagcttacgtgctatcccatggatttttgcatggagccaa
aaccgtttaatgttaccggcatggttaggtacaggtggatcattaaaaacattactggat
gaaggtaaaaaagagctattacaagaaatgtattgtaactggccgttcttccatacccgc
ctagaaatgctagaaatgctgttcttaaaaacagatgctggcttgactaagttttatgaa
gagcgccttgtgcctaaatcattatggcctttgggtcagcgtttacgtgataatttatca
ttaactcgcgaagtgcttttagaaactatccctgagcataaattaatgcaagagcaacct
tggataaaagagtctatttctttacgtaatccttatgttgatccgttgaatatgctgcaa
gcagagttactgtctcgttcgcgcgctaatggtgatgaaatttgcccggtgattgatcaa
gctcttatggtaaccatcgcaggtattgctgccggtttacgtaatactggttaa

DBGET integrated database retrieval system