KEGG   Psychromonas sp. CNPT3: PCNPT3_05030Help
Entry
PCNPT3_05030      CDS       T02515                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
psy  Psychromonas sp. CNPT3
Pathway
psy00020  Citrate cycle (TCA cycle)
psy00190  Oxidative phosphorylation
psy00650  Butanoate metabolism
psy01100  Metabolic pathways
psy01110  Biosynthesis of secondary metabolites
psy01120  Microbial metabolism in diverse environments
psy01130  Biosynthesis of antibiotics
psy01200  Carbon metabolism
Module
psy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
psy_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:psy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PCNPT3_05030 (sdhA)
   00650 Butanoate metabolism
    PCNPT3_05030 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PCNPT3_05030 (sdhA)
Enzymes [BR:psy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PCNPT3_05030 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     PCNPT3_05030 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA BEX DAO HI0933_like FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AGH80948
UniProt: M4U3J8
LinkDB All DBs
Position
1183026..1184792
Genome map
AA seq 588 aa AA seqDB search
MTLPIREFDAIVIGAGGAGMRTALSISEQGKTCALITKVFPTRSHTVSAQGGITVALGNA
HEDDWQWHMYDTVKGSDYIGDQDAIEFMCKSGPEVVRELENMGLPFSRFEDGSVYQRPFG
GQSKAFGGEQAARTAAAADRTGHALLHTLYQQNIKNKTTIFSEWYALDIVKNDDGVVVGC
TAIDIESGEIVFFKAQATVFATGGAGRIYASTTNAHINTGDGIGMAIRAGVPVQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKDGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCEGPWGLHVKLKLDHLGEELLESKLPGICELSRTFAHVDPVKEPIPVIPTCHYMMGGL
PTTINGQVLKVDENGKDIDMPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRATGQHLG
KVLSQENTAKEATQENIDASLARLNRWEHGDGTECPEQIRKDLQQCMQNNFSVFREGDAM
ATGLEELKVLRKRLQNAVLNDHSKEFNTARIECLELDNLMETAYATAVAANFRTESRGAH
SRFDFPDRDDKTWLCHSLYDPVQDKMSKRAVNMSPVLREAFPPKARVY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
gtgacattacctatccgagagtttgatgcaattgtaattggtgcaggtggtgctggtatg
cgcactgcactttctatttctgaacaaggtaaaacctgtgctctaattaccaaggttttt
ccaacgcgatcacatactgtgtctgcccaaggtggcatcactgttgcgctaggcaatgcg
catgaagatgattggcagtggcatatgtacgatacggtcaagggctctgattatattgga
gatcaagatgcgattgagttcatgtgtaaaagtggcccagaggtggtacgtgagctcgaa
aatatgggactgcctttttcacgttttgaggatggcagtgtttatcagcgtccttttggt
ggtcagtctaaagcgtttggtggggagcaagctgcacgtacggcggccgccgccgataga
accggtcatgcattactgcatacgctttatcagcaaaatattaaaaataaaaccacaata
ttttcagagtggtatgcacttgatattgtcaaaaatgatgatggcgtagtcgtcggttgt
actgcgatagatattgaatcgggtgaaattgttttctttaaagcacaagcgactgttttt
gcaacgggtggtgcggggcgtatttatgcctcaacaacgaatgcacacattaatactggc
gatggtattggtatggcgatacgcgctggcgtaccggtgcaagatatggaaatgtggcag
tttcatccaaccgggattgcgggcgcaggcgtgcttgttaccgaaggttgtcgtggtgag
gggggttatcttttaaataaagatggcgagcgttttatggaacgttatgcaccgaatgcc
aaagatttagccggacgtgatgtggttgcacgatctattatgattgaaattcgtgaagga
cgaggttgtgaaggaccttggggtctacacgttaaattaaaattagatcatctcggtgaa
gaactattagagtcaaaattaccggggatttgtgagttatcacgcacctttgcacatgtt
gatcccgttaaagagcctattcccgttattccaacatgtcattacatgatgggtggttta
cccaccacgataaatggtcaggtacttaaagttgacgaaaatggtaaagacatcgatatg
ccgggactctttgccgttggcgaaattgcctgtgtatccgtgcatggagcgaatcgttta
gggggtaactcgttattagatttagtggtatttggacgcgcgacagggcaacacttagga
aaagttctaagccaagaaaatacggctaaagaggcaacacaagaaaatattgatgcatca
ttggcgcgattaaatcgttgggaacatggcgatggcacggaatgccctgagcagatacgt
aaagatttacagcaatgtatgcaaaataatttttcagtgtttcgagaaggtgatgcgatg
gcaaccggtcttgaagaacttaaagtattacgtaaacgcttacaaaatgccgtattaaat
gatcacagtaaagaatttaataccgcgcgtattgaatgtttggagttggataatttgatg
gaaacggcttacgctacggcggtagctgctaactttagaaccgagagtcgaggcgcacat
agtcgttttgattttccggatagagatgataagacgtggttatgtcatagcttatatgat
cccgtgcaggacaaaatgagtaaacgagcggtgaatatgtcgcccgtattacgtgaagca
tttccacctaaagcacgtgtttactaa

DBGET integrated database retrieval system