KEGG   Psychromonas sp. CNPT3: PCNPT3_05035Help
Entry
PCNPT3_05035      CDS       T02515                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
psy  Psychromonas sp. CNPT3
Pathway
psy00020  Citrate cycle (TCA cycle)
psy00190  Oxidative phosphorylation
psy00650  Butanoate metabolism
psy01100  Metabolic pathways
psy01110  Biosynthesis of secondary metabolites
psy01120  Microbial metabolism in diverse environments
psy01130  Biosynthesis of antibiotics
psy01200  Carbon metabolism
Module
psy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
psy_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:psy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PCNPT3_05035
   00650 Butanoate metabolism
    PCNPT3_05035
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PCNPT3_05035
Enzymes [BR:psy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PCNPT3_05035
    1.3.5.4  fumarate reductase (quinol)
     PCNPT3_05035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4 Fer4_6
Motif
Other DBs
NCBI-ProteinID: AGH80949
UniProt: M4U3Z0
LinkDB All DBs
Position
1184807..1185520
Genome map
AA seq 237 aa AA seqDB search
MNVKFSIYRYNPDIDNAPYMQDLSLEVEPGNDMMVLDALILLKEADASLSFRRSCREGVC
GSDGLNINGKNALACITPLSDLLNAGKIVIRPLPGLPVIRDLVIDMTQFYTQYEKVKPYL
ISDGALPPAGEFKQSPEQRKELDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRF
LIDSRDTATESRLADLDDAFSVFRCHGIMNCVSVCPKGLNPTKAIGKIKSMLLQRAI
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtcaaattttcaatttatcgttataacccagatattgataatgcgccgtatatg
caagatctttctttagaggttgagcctggaaacgatatgatggtgctcgatgcacttatc
ttactcaaagaagcagatgcatcattaagttttcgacgctcttgtcgagaaggtgtgtgt
ggctcggatggtttaaatattaatggtaaaaatgcgctagcatgtattacgcctctttcg
gatttacttaatgcggggaaaatagtgatccgcccgttaccgggattaccggttatccgc
gacttggtcattgatatgacgcaattttatacacagtatgaaaaagtaaaaccgtatctg
atcagcgatggggccttgccgccagcgggtgaatttaagcaatcaccagagcaacgtaaa
gagctagatggtttatacgaatgcattttatgtgcttgttgctcaacctcttgcccttca
ttttggtggaatccagataaatttattggtccagcaggattacttgccgcctatcgcttt
ttaattgatagtcgagatacagcaacagagtctcgtttagcagatttagacgatgcattt
agtgtatttcgttgtcatgggatcatgaattgtgtcagtgtttgtcctaaaggtttgaac
ccaacaaaagccattggtaaaattaaatcaatgttattacaacgcgctatataa

DBGET integrated database retrieval system