KEGG   Psychromonas sp. CNPT3: PCNPT3_07160Help
Entry
PCNPT3_07160      CDS       T02515                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
psy  Psychromonas sp. CNPT3
Brite
Enzymes [BR:psy01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PCNPT3_07160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AGH81370
UniProt: M4ULR8
LinkDB All DBs
Position
complement(1699298..1699879)
Genome map
AA seq 193 aa AA seqDB search
MAFELPALPFAKNALEPHISAETLEFHYEKHHATYVLKLNGLVEGTEFESQSLEEIVKTT
SGPMFNNAAQVWNHTFYWNCLAPNAGGVATGAIGDAIVKQFGSFEKFQSTFNDKAVNNFG
ASWTWLVKKADGTLEIVNTSNAGTPLTDDSVTVLLTVDLWEHAYYIDYRNVRPNYLNGFW
ALVNWDFVNNNFA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaattacctgcattaccttttgcaaaaaatgcgctagaaccacatatttca
gcagagacattagagtttcattatgaaaagcatcatgcaacgtacgtgcttaaactaaat
ggtttagtcgaaggtactgagtttgagagtcaatcattagaagagattgttaaaacgacc
agtggcccaatgtttaataatgcggcacaggtttggaaccatactttctattggaactgt
ctagcgcctaatgccggcggcgttgcaacgggtgctatcggagatgcgattgttaaacaa
tttggatcttttgaaaaattccaaagcacttttaatgataaagccgttaataactttggt
gcgtcatggacttggttagttaaaaaagcagacggaacacttgaaatcgttaatacttca
aacgcaggaacgcctttaactgacgattctgtgactgtattattaaccgtagatttgtgg
gaacacgcatattacattgattatcgtaacgtacgtcctaactacttaaatggtttttgg
gcattagttaattgggacttcgtgaataataacttcgcgtaa

DBGET integrated database retrieval system