KEGG   Psychrobacter sp. AntiMn-1: AOT82_1685Help
Entry
AOT82_1685        CDS       T04964                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
psya  Psychrobacter sp. AntiMn-1
Pathway
psya00020  Citrate cycle (TCA cycle)
psya00190  Oxidative phosphorylation
psya00650  Butanoate metabolism
psya01100  Metabolic pathways
psya01110  Biosynthesis of secondary metabolites
psya01120  Microbial metabolism in diverse environments
psya01130  Biosynthesis of antibiotics
psya01200  Carbon metabolism
Module
psya_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psya_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
psya_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:psya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AOT82_1685
   00650 Butanoate metabolism
    AOT82_1685
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AOT82_1685
Enzymes [BR:psya01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AOT82_1685
    1.3.5.4  fumarate reductase (quinol)
     AOT82_1685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_18 Fer4
Motif
Other DBs
NCBI-ProteinID: AOY44064
UniProt: A0A1D9CZS5
LinkDB All DBs
Position
complement(1887054..1887764)
Genome map
AA seq 236 aa AA seqDB search
MSRGTRTIEIYRYDPDVDAAPRMQTYTIELLDSDRMLLDVLLRLKKEDETITFRRSCREG
ICGSDGMNINGKNGLACLINMNTLPEKVTVRPLPGLPVVRDLVVDMNQFYEQYEKVHPYL
INDQPAPPTERLQSPAEREKLNGLYECILCACCSTSCPSFWWNPDKFLGPSALLHAYRFV
ADSRDGDTQARLARLDDPFSLFRCRGIMNCVSVCPKGLNPTKAIGHLRNMLIDQAG
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgagccgaggtactcgcaccatcgaaatctatcgctacgatcctgatgtggacgcagcc
ccacgcatgcaaacttatacgattgaattacttgattcagatcgtatgttgcttgacgtg
ttattacgcctaaagaaagaagatgaaacaatcactttccgccgctcttgccgtgaaggt
atttgtggttctgatggcatgaacatcaatggtaaaaatggtctagcatgtctaatcaac
atgaacacgctaccagaaaaagtaaccgttcgtccgttacctggtttgccagtggttcgt
gacttggttgttgatatgaaccaattctacgagcaatacgaaaaagtacatccgtactta
atcaatgatcagccagcacccccaactgagcgtctgcagtctcctgctgagcgtgaaaag
ttaaatggtctgtatgagtgtattctgtgtgcatgctgctcaacgagctgcccatctttt
tggtggaaccctgataagttcttaggtccatcagcgttgctacatgcgtatcgctttgtg
gctgacagccgtgacggtgacacgcaagcacgtttggcgcgtttagacgatccgttcagt
ttattccgttgccgcggtatcatgaactgtgtgtcagtttgtccaaaaggcttgaaccca
accaaagcaatcggtcatttacgtaatatgttgattgatcaagctggttaa

DBGET integrated database retrieval system