KEGG   Psychrobacter sp. AntiMn-1: AOT82_1686Help
Entry
AOT82_1686        CDS       T04964                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
psya  Psychrobacter sp. AntiMn-1
Pathway
psya00020  Citrate cycle (TCA cycle)
psya00190  Oxidative phosphorylation
psya00650  Butanoate metabolism
psya01100  Metabolic pathways
psya01110  Biosynthesis of secondary metabolites
psya01120  Microbial metabolism in diverse environments
psya01130  Biosynthesis of antibiotics
psya01200  Carbon metabolism
Module
psya_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psya_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
psya_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:psya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AOT82_1686
   00650 Butanoate metabolism
    AOT82_1686
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AOT82_1686
Enzymes [BR:psya01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AOT82_1686
    1.3.5.4  fumarate reductase (quinol)
     AOT82_1686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO Thi4 Pyr_redox_2 FAD_binding_3 Pyr_redox_3 GIDA HI0933_like NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AOY44065
UniProt: A0A1D9CZR9
LinkDB All DBs
Position
complement(1887971..1889821)
Genome map
AA seq 616 aa AA seqDB search
MATRQDNTISNIKTLNYDAVIVGGGGSGMRASLHLAEAGMKVAVLTKVFPTRSHTVAAQG
GIGASLGNMSNDNWHFHFYDTVKGSDWLGDQDAIEYMCREAPKVVYELEHMGMPFDRNED
GTIYQRPFGGHTSNYGEKAVQRACAAADRTGHALLHTLYQKNLQQGTEFFIEWIALDLIK
DEAGNINGVIALEQETGTVAVFQAPVTVLATGGAGRIFAASTNAYINTGDGIGMAVRAGI
PLQDMEFWQFHPTGVHGAGVLLTEGCRGEGAILRNKDGEAFMERYAPTVKDLAPRDLVSR
SMDQEIKEGRGCGPNADHIVMDMTHLGVDTIMKRLPSVFEIGKNFANVDITKEPIPVIPT
IHYMMGGIPTTIHGQVIVPDLEAGTDEDGLYANGNVVKGLYAIGECACVSVHGANRLGTN
SLLDLVVFGRAAGKHIVDEFHQNDHNYKPLDPHVLDITVGRLNKLQQSTSGYNAQDVADE
IRATMQKHASVFRTQAMMDEGVEKILALGEKVEQIHLGDKSQVFNTARIEAFEVANLYEV
AKATMVSAASRHESRGAHSVSDYDRPEDDDYAPNGRNDHDWMKHTLWYSEGNRIIYKPVR
KVPLTVDYIEPKVRVY
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atggcaactagacaagacaataccattagtaatattaagaccctaaactacgatgcagtt
atcgttggtggcggtggttcaggtatgcgcgcttcattgcacttagcggaagcgggtatg
aaggttgcagtcctgaccaaagtattcccaacacgttcgcacacggttgccgctcagggt
ggtatcggtgcaagtttgggcaacatgagtaacgacaactggcacttccatttttatgac
accgtaaaagggtcagattggttaggtgaccaagacgctatcgagtatatgtgccgtgaa
gcaccaaaggtagtctatgagcttgagcacatgggcatgccgtttgaccgtaacgaagat
ggtacgatttatcagcgtccattcggcggtcatacgtcaaactatggcgaaaaagcggta
caacgtgcgtgcgctgctgctgaccgtacaggtcacgcattgctacacacgctgtatcag
aaaaacttacagcaaggcactgagttctttatcgagtggattgcgcttgatttgatcaaa
gacgaagcgggtaacatcaacggtgttatcgctcttgagcaagagacaggtactgttgcg
gtattccaagcaccagttactgttctagcaacaggtggtgcaggtcgtatctttgccgct
tctaccaacgcttatatcaacactggtgatggtattggtatggcagttcgcgctggtatc
ccactacaggatatggagttctggcagttccatccaacgggcgttcatggtgcaggtgta
ctattgaccgaagggtgccgcggcgaaggtgctatcttgcgtaacaaggatggcgaagct
ttcatggagcgttatgccccaaccgttaaagatttggcaccacgtgatctcgtatcgcgc
tctatggaccaagaaattaaagaaggtcgtggttgtggccctaatgctgaccatatcgtc
atggacatgacccatttgggtgtcgacactatcatgaagcgtctaccgtcagtatttgag
atcggtaaaaacttcgccaacgttgacattactaaagaacctattccagttatcccaacc
attcactacatgatgggtggtattccaaccactatccatggtcaggtaatcgtgccggat
ctagaggcaggtacagatgaagacggtttatatgctaatggtaacgtcgttaaaggacta
tacgctattggtgagtgcgcttgtgtgagtgtacacggtgccaaccgtttaggtaccaac
tcactacttgatttggttgtgtttggtcgtgctgctggtaagcacattgttgatgagttc
catcaaaatgatcataactacaaaccacttgatccgcatgtacttgatatcacggttggt
cgtttaaacaaattgcagcaatcaacatcaggctacaatgcacaagacgtggctgatgag
attcgtgcgacgatgcagaaacacgccagtgtattccgtacgcaagccatgatggatgaa
ggcgttgagaaaattttagcgctgggtgagaaagtcgaacaaatccatttgggtgataaa
tcacaagtcttcaacactgctcgtatcgaagcgtttgaagtggcaaacctatacgaagta
gcaaaagcgacgatggtatcagccgcgagccgccacgaaagccgcggcgcgcatagtgtc
tctgattatgatcgtccagaagatgatgactatgcaccaaacggccgtaatgaccacgat
tggatgaagcatactttatggtattctgaaggcaaccgtatcatttacaaaccagttcgc
aaagtgccactgactgttgactatatcgaaccaaaagttcgcgtctattaa

DBGET integrated database retrieval system