KEGG   Psychrobacter sp. AntiMn-1: AOT82_2136Help
Entry
AOT82_2136        CDS       T04964                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
psya  Psychrobacter sp. AntiMn-1
Brite
Enzymes [BR:psya01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AOT82_2136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AOY44515
UniProt: A0A1D9D125
LinkDB All DBs
Position
2374997..2375626
Genome map
AA seq 209 aa AA seqDB search
MSNITLPDLPYAKDALEPHISAETLEYHHDKHHAAYVNKLNELLPGSGLEDKTLPEIIKA
TAKDDSKQGMFNQAAQVWNHTFYWNCMTPTNGGGEPTGDLKAKIEEDFGSYDKFREEFKN
AATSQFGSGWAWLVADKVGGKLSIAKTGNADTPLAHDQVAVLTCDVWEHAYYIDYRNRRP
DYVDTFLDKLVNWDYANAKYKGQDAGVEE
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatattactttaccagatctcccatatgcaaaagacgcgctagagccacatatc
agtgccgagacgctagaatatcatcatgacaagcatcatgctgcttacgtaaacaagtta
aatgagctactaccaggttctggtttagaagacaaaaccttaccagaaatcatcaaagcg
actgctaaagatgacagcaagcaaggtatgttcaaccaagccgctcaagtatggaaccac
acgttctactggaactgcatgacgccaaccaacggcggcggcgaacctactggcgatcta
aaagcaaaaatcgaagaagattttggcagctatgacaagttccgcgaagagttcaaaaat
gcggcaacttcacagttcggttcaggctgggcatggctagtcgctgataaagtgggtggc
aaactgtctatcgccaaaactggcaacgcagacaccccactagcgcacgaccaagtcgct
gtattgacttgtgatgtatgggaacacgcatactacatcgactaccgtaaccgtcgtcct
gactacgtagataccttcctagacaagctcgtaaactgggactacgcaaacgcaaaatat
aaaggtcaagacgcaggcgttgaagagtaa

DBGET integrated database retrieval system