KEGG   Psychrobacter sp. AntiMn-1: AOT82_2301Help
Entry
AOT82_2301        CDS       T04964                                 

Definition
(GenBank) alkyl hydroperoxide reductase F52A protein (subunit F)
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
psya  Psychrobacter sp. AntiMn-1
Brite
KEGG Orthology (KO) [BR:psya00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AOT82_2301
Enzymes [BR:psya01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AOT82_2301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like Thioredoxin_3 FAD_binding_2 NAD_binding_8 Thi4 DAO FAD_oxidored K_oxygenase AlaDh_PNT_C NAD_binding_7 Shikimate_DH Lycopene_cycl FAD_binding_3 3HCDH_N Glutaredoxin Thioredoxin_14
Motif
Other DBs
NCBI-ProteinID: AOY44680
UniProt: A0A1D9D1I4
LinkDB All DBs
Position
2565965..2567542
Genome map
AA seq 525 aa AA seqDB search
MIDQNLLDAVKTYSENMTRPITFVLGSGEHDKRAELIDFLSKIAGTTDKINFDEQVIDDS
LPSAISFKVVSHVDGETADTGIVFSGIPGGHEFTSLILAILQAGGHTLKLDEGIQKLIKR
FNKPLQFQTYVSLSCHNCPEVVQALNQFALLNDGISNEMIDGALFQEQVEANKIQGVPAV
FLNGKPFANGLIDTAKLIGKLQEQFPDLLSDVEDDAEQLEQQDVTVIGAGPAGVAAAIYT
ARKGLKVTMVADRIGGQVKDTQDIENLISVPLTNGTDLSTNFVKHLAEYNITLREHVSVK
DIGETEEENYSINLNTGETFETRSIILATGAQWRKLGVPGEEENIGKGVAFCAHCDGPFF
KGKDISVIGGGNSGVEAALDLAGIVKHVTVLEFADELKADQVLINKAKEKSNIEFITGAA
TQEIKATDGKVSSIVYQDRSTGETHERDLSGVFVQIGLVPNTEFVKGFVDLNRFGEIEID
ERCRTDRKGIFACGDVTTVPFKQINIAMGEGSKAALAAFEYLVMQ
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgatagatcaaaatttattagacgcagttaagacatatagcgaaaacatgacgcgcccg
attacttttgtattgggtagcggtgagcacgataagcgcgctgaattgatcgactttttg
agcaagattgcgggtacgactgacaaaatcaatttcgatgagcaggttatcgatgacagt
ttgccaagcgcgattagttttaaagtagtcagtcatgttgatggagagactgctgataca
ggtatcgtatttagtggtattcctggtggtcatgagtttacctcattgatcctagccatt
ttgcaagcgggtggtcatacgctgaaattggatgaaggtatccaaaagctaatcaaacgc
ttcaacaagccgctacagtttcagacctacgtgtcactatcatgccataactgcccagaa
gtggttcaggcgttgaatcaatttgcgctactaaacgatggtatcagcaatgagatgatc
gatggtgcgctcttccaagagcaagtagaagcaaacaaaatccaaggtgtaccggccgta
ttcttgaacggtaaaccatttgccaatggtctgattgatactgccaaactgattggaaaa
ttacaagagcagtttcctgatctgttgtcagatgtggaagatgatgctgagcaactagag
cagcaagatgtcactgtcattggtgcaggtcctgcaggcgttgcagcagctatttatacc
gcgcgtaaaggcttaaaagtcaccatggtcgctgatcgtatcggtggacaagtcaaagac
acgcaagatatcgaaaacttgatctctgtacctttaaccaatggtactgatttgtcgact
aatttcgttaagcacttggctgagtacaatatcacgctaagagagcatgtcagtgtgaaa
gatatcggcgagacagaagaagaaaactacagcatcaatctaaataccggcgagacgttt
gaaactcgtagtattatcttggcgacaggtgcccaatggcgtaagcttggcgtaccgggc
gaagaagaaaatatcggtaaaggcgtggcgttttgtgcccactgtgatggtccattcttc
aaaggtaaagacatctcagtgatcggcggtggtaactcaggcgttgaggctgcgttagat
ctggcaggcattgttaagcacgtcactgtattagagttcgctgatgagttaaaagcagac
caggtattgatcaataaagccaaagagaaatccaatattgaattcatcactggtgcggcg
acgcaagagatcaaggcgactgatggcaaagtatcgtccatcgtctatcaagatcgcagc
acaggcgagacacatgagcgtgatttatcaggtgtgtttgtacaaatcggtctcgtacca
aacactgaatttgtcaaaggctttgtcgatttaaaccgctttggtgagattgagattgat
gagcgctgccgcaccgatcgcaaaggtatttttgcttgcggtgatgtgaccaccgtacca
tttaagcagattaatattgcaatgggtgagggtagtaaagcagcattggcagcatttgaa
tatttggttatgcagtaa

DBGET integrated database retrieval system