KEGG   Psychrobacter sp. AntiMn-1: AOT82_2344Help
Entry
AOT82_2344        CDS       T04964                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
psya  Psychrobacter sp. AntiMn-1
Pathway
psya00020  Citrate cycle (TCA cycle)
psya00270  Cysteine and methionine metabolism
psya00620  Pyruvate metabolism
psya00630  Glyoxylate and dicarboxylate metabolism
psya00680  Methane metabolism
psya01100  Metabolic pathways
psya01110  Biosynthesis of secondary metabolites
psya01120  Microbial metabolism in diverse environments
psya01130  Biosynthesis of antibiotics
psya01200  Carbon metabolism
Module
psya_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psya_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
psya_M00012  Glyoxylate cycle
psya_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:psya00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AOT82_2344
   00620 Pyruvate metabolism
    AOT82_2344
   00630 Glyoxylate and dicarboxylate metabolism
    AOT82_2344
  Energy metabolism
   00680 Methane metabolism
    AOT82_2344
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AOT82_2344
Enzymes [BR:psya01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     AOT82_2344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N Glyco_hydro_3_C
Motif
Other DBs
NCBI-ProteinID: AOY44723
UniProt: A0A1D9D1R2
LinkDB All DBs
Position
2604288..2605277
Genome map
AA seq 329 aa AA seqDB search
MSMKQPLRVAVTGAAGNISYAMLFRIASGEMLGKDQPVILQLLEITPALDALKGVVMELE
DCAFPLLAGIVQTDDANVAFKDADYALLVGARPRGPGMERKDLLEANAAIFSAQGKALNE
VASRDVKVLVVGNPANTNALIAQRNAPDLDPRNFTAMTRLDHNRAMAQLAEKTDSTVNDI
KNMTIWGNHSSTQYPDLTAATVNGKPALELVDRDWYENTYIPEVQQRGAAIIKARGASSA
ASAANAAIAHMRTWALGTDENDWVSMGVYSNGEYGIAEGLIYSFPCTCKNGDWSIVDGVD
VSSEFSKEKMAATEQELSEERDAVAHLLP
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatgaaacagcctttacgtgttgccgtcactggtgccgctggtaatatcagctac
gcgatgctatttcgtattgcatctggcgagatgctaggtaaagatcagccagttattttg
caattgcttgaaatcacaccagcgcttgatgccctaaagggtgtggtcatggaactagaa
gactgcgcattcccattgcttgctggtattgtccaaactgatgatgcaaatgtggcattc
aaagatgctgactacgcgttactcgtcggtgcccgtccacgtggtccaggtatggagcgt
aaggacttactagaagccaacgctgcgattttctcagcacaaggcaaagcattaaacgaa
gtcgctagccgtgatgtaaaagtattggtcgtcggtaaccctgccaacaccaacgcgcta
atcgctcagcgtaacgcaccagacctagatccacgtaactttactgccatgactcgccta
gatcataaccgtgcgatggcacagctagccgaaaaaactgacagcactgttaatgacatc
aaaaacatgaccatctggggcaaccactcatcgacccagtatccagacctaacggctgcg
actgtcaatggcaaaccagcgctagagttggttgatcgtgattggtacgaaaacacgtat
atcccagaagtacagcagcgcggcgcggccatcattaaagctcgcggcgcctcatctgca
gcttctgctgccaacgctgctatcgcccatatgcgcacgtgggcactcggtactgacgag
aacgattgggtctctatgggtgtttactcaaatggggaatatggtatcgctgaaggcctt
atctactcattcccatgcacatgcaaaaacggcgactggtctatcgtagacggcgttgat
gtgtcatcagaattctcaaaagagaaaatggccgccactgagcaagagctgagcgaagag
cgtgatgcagtagcacacctactaccataa

DBGET integrated database retrieval system