KEGG   Psychrobacter sp. AntiMn-1: AOT82_2358Help
Entry
AOT82_2358        CDS       T04964                                 

Definition
(GenBank) D-alanine:D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
psya  Psychrobacter sp. AntiMn-1
Pathway
psya00473  D-Alanine metabolism
psya00550  Peptidoglycan biosynthesis
psya01100  Metabolic pathways
psya01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:psya00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AOT82_2358
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AOT82_2358
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AOT82_2358
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:psya01011]
    AOT82_2358
Enzymes [BR:psya01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AOT82_2358
Peptidoglycan biosynthesis and degradation proteins [BR:psya01011]
 Precursor biosynthesis
  Amino acid ligase
   AOT82_2358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp TTL ATPgrasp_YheCD ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AOY44737
UniProt: A0A1D9D1Q9
LinkDB All DBs
Position
2619981..2621081
Genome map
AA seq 366 aa AA seqDB search
MTTNNKGNMSTQNLAIDDTEDRSAITNPEPALAAAAQAGQSDASISPNEEENKKSISTMT
GHVKDAAQFGKVAVIYGGSSNERSVSLDSGAAVLQALQNQGVDATHFDPKHQDITELRDY
DRVFNVLHGRGGEDGLLQGVLQWFDIPQTGSGVLASALGMDKVRTKQLWQGCGLSTAPFS
LLTADTDWQQVVNMLGLPLIIKPVHEGSSIGMTKVNHLDELPAAYATAVQCGDAVMAERW
ITGREFTIVIIDDEAYPVIRLEPADITNFYDFEAKYNRNDTSYYIPCGLSAADEKHLQEL
SLAAFRAVDAKGWGRIDAMQDEAGNFWLLEINTVPGMTSHSLVPMAAKARGMDFDTLCWH
ILSQTV
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgacgactaataataaaggaaacatgagtactcagaacctcgctatcgatgataccgaa
gatagatcagccatcaccaatccagaaccagcattggcggcggctgcacaagcaggacaa
agcgacgcgagcatttcgccaaatgaggaagagaataaaaaatctatcagtacgatgact
ggtcatgtaaaagatgccgctcagtttggtaaagtcgctgtgatctatggtggtagtagc
aatgagcgcagcgtgtctttggatagcggtgcggctgtattgcaggcactgcaaaaccaa
ggtgtcgacgccactcattttgatcctaagcatcaagacatcacagaattacgtgattac
gatcgcgtgtttaatgtcttgcacggtcgtggcggcgaagacggtctactgcaaggtgta
ttacagtggtttgatataccgcaaacgggatctggcgttttggcatcagcattaggtatg
gacaaagtgcgtaccaaacagctctggcaaggttgcggcttatccacagcaccgttttca
ttattgacagctgataccgactggcagcaagtggtcaatatgctaggactgccgcttatc
attaaacccgttcacgaaggctcaagtattggcatgaccaaggtcaatcatctcgatgaa
ttgcctgcggcctatgctactgccgtacagtgtggtgatgccgtgatggctgagcgctgg
atcacaggtcgtgagtttacgattgtgattatcgatgacgaagcttatcctgtcattcga
cttgagcctgctgatatcaccaatttctatgactttgaggccaagtataatcgtaacgat
accagctactatattccttgcggattgagcgctgctgatgagaagcatctgcaagagtta
agtctggcggcattccgtgctgtagatgcaaaaggttggggacgtattgacgccatgcag
gatgaagcagggaatttttggttgcttgagatcaataccgtgcccggtatgaccagtcat
agtttggtaccaatggcagccaaagctagaggcatggattttgacacattgtgctggcac
atattatctcagacagtctaa

DBGET integrated database retrieval system