KEGG   Psychrobacter sp. AntiMn-1: AOT82_413Help
Entry
AOT82_413         CDS       T04964                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
psya  Psychrobacter sp. AntiMn-1
Pathway
psya00620  Pyruvate metabolism
psya00680  Methane metabolism
psya01100  Metabolic pathways
psya01120  Microbial metabolism in diverse environments
psya01200  Carbon metabolism
Module
psya_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:psya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AOT82_413
  09102 Energy metabolism
   00680 Methane metabolism
    AOT82_413
Enzymes [BR:psya01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AOT82_413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AOY42792
UniProt: A0A1D9CW80
LinkDB All DBs
Position
complement(479012..481798)
Genome map
AA seq 928 aa AA seqDB search
MTLDNNVLRKRTSLLGSLLGDAISRQSGEQTIKTIETLRKGFIQQRREPNEAHKQQLIDF
IASLDNQTLKNVIRGFSIYFFLANLSEENYLREQRHELRMQSEQSWEGSFRRTLLECRER
NIEPAQMQELIDQLKFIPVFTAHPTEARRRTTMNILQSLFTHSEALNNVSENSFAYEQAK
EQTAQTIDLLWSSDEVRTRKPLVYDEINNGLHYFNASLFNAIPKVYRNIKKAIVDIYPEL
TDYPLPAFMSFGSWIGGDRDGNPFVTFETTELAVLMHADTVLRHYQVLLKKLRRQLIHSD
TIVTVSPDVYAKIKSYDELDQRVFDYNLDDYGNEPYRRLLSLILTKVNATNRRIQSKGTD
IEAEKDAYANPEELLEDLRIIRQSVATHDKAHADGLLLDVIRLVKTCGFHLAALDIRQES
SYHGEVIADIFASASNLPDYQTLSETERQEWLTRLLEKPGTPLIYTDNLTDKTREQLSLM
NSVATLRKLVGQATFGSYVISMTNNASQLLEVLLLMRFAGLCTIDADGQLSADLPVAPLF
ETIEDLKNIDKILPAVLDNPLYRGLLQNTDNTQEIMLGYSDSSKDGGIITSAWQLYSAQQ
TINSIAEQYGIKTRLFHGRGGSVSRGGGSTHKAIAAQPAGTLHGQIKVTEQGEVLYAKYA
NTDTAVFELTMAITGTLKACSTRFVVQPTELPEYEALFARLAEAGEQRYRELTDHTEGFY
KFYSQVTPVQEISLLNIGSRPAHRKKGLPSKTTLRAIPWVFGWSLARFTLPAWYGVGSAL
HSVRDNEILMKEMNARWPFFSVFISNIEMAFTKSEMNIAQAYSQLCDDEALREQIMSEVL
DEHELTSSGLNSLLDQETLLSGQRNLAASLQWRDAYLDPINYIQIELLKRARQQNEDTTD
NHKDGDLNVEDPLIRSINALAAGLRNTG
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgactttagataataacgtactacgtaaacgcaccagcttattgggttcattgctaggc
gatgccatttctcgccaatctggagagcagacaataaagaccattgagaccctgcgtaaa
ggtttcattcaacagcgccgtgagccaaatgaggcacataaacagcagcttatcgacttt
attgcgtctttggacaatcaaactttaaaaaacgtcatacgtggattttctatctatttt
ttcctagccaatctaagcgaagaaaactacttgcgtgagcagcgtcatgagctgcgtatg
caatcggagcaaagctgggaggggtcatttcgccgtactttacttgaatgtcgtgaacgc
aatatcgagccggctcaaatgcaagagcttattgatcagctcaaatttatacctgtattt
acggcgcatcctaccgaagcgcgtcgccgtaccacaatgaatatcttacaaagtctattc
acgcacagcgaagctttaaacaatgtgtctgaaaacagtttcgcctacgaacaagccaaa
gagcaaaccgcacagacgattgatctactatggtcatcagatgaggtgcgcacccgcaag
ccgctggtctatgacgagattaacaacggcctgcattactttaacgccagcttatttaat
gccattcccaaagtatatcgcaatatcaaaaaagccattgtcgatatctatccagagctc
accgactatccactgcctgcctttatgagctttggttcatggattggcggtgatagagat
ggcaatccttttgtgacgtttgagaccacagagcttgccgtcttaatgcatgcggatacc
gtactgcgtcactatcaagtactactcaaaaaactgcgccgccagctcattcatagtgac
actattgtcaccgtgtctcccgacgtatatgccaagatcaaaagttatgatgagctcgat
cagcgtgtatttgattacaacctcgatgattacggcaacgagccataccgccgtctgctt
tctttaatactcactaaggtcaatgccaccaatcgccgcattcaaagcaaagggactgac
atcgaggctgaaaaagacgcatacgccaatccagaagagctgctagaggacttacgtatt
atccgccaaagtgtcgctactcacgacaaggcgcatgcagatgggttgttgctcgatgtg
attcgcctggtaaaaacttgcggctttcatttggcggcgctcgatatccgtcaagagtcg
tcttatcatggtgaagtgattgcagatatctttgcgagtgcttccaacctgcctgattat
caaacgctaagcgaaaccgaacgtcaagagtggctcacacgcttgttagaaaaaccgggt
acgccgctcatctatactgataacctaacagacaaaacgcgtgagcaattgtcattgatg
aattcggtcgccaccttacgcaaattggtgggacaggcgacttttggcagctatgttatc
tcaatgacgaacaatgccagccagctactagaagtgttgctgttaatgcgatttgcaggc
ttatgtacgattgatgctgacggtcaattgtctgctgatctacctgtcgcaccgttgttc
gaaaccatcgaagatcttaaaaacatcgataaaatcttgcctgctgtgttagacaatcca
ctatatcgcggattgctacagaatacagataatacgcaagagatcatgctaggttattcg
gactcatcaaaagatggcggtatcatcacctcggcttggcagctgtatagtgcgcagcaa
accattaatagtattgctgagcaatatggtataaaaacacggttattccatggtcgcggc
ggttcggtgagtcgcggcggcggatcaacgcacaaagccattgcggcacagccggctggc
acgttacatggtcagattaaagtgaccgaacaaggcgaagtgctttatgccaaatatgcc
aatacggatactgccgtgtttgagctgaccatggcaatcacgggtacactcaaagcctgc
tcgacaagatttgtcgtgcaaccgactgagttaccagagtatgaagccttgtttgcacgg
ttagcagaagcaggcgaacaacgttatcgagagctgaccgatcatacggaagggttttat
aaattctactcacaagtgaccccagtacaagaaatctccttactgaacattggctcacgt
cctgcccatcgcaaaaaaggcttgccaagtaaaaccacattgcgagcgattccttgggta
tttggctggtcgttagcacgctttaccctacctgcttggtatggcgttggtagtgctctg
catagtgtcagagacaacgagattttgatgaaagagatgaatgcgcgctggccatttttt
agtgtctttatcagtaatatcgagatggcttttaccaaatctgagatgaatattgcacaa
gcatatagccagttgtgtgatgacgaggcgctacgcgaacagatcatgagtgaggtgctc
gatgagcatgagctgacttcttccggtctgaattctttgctagatcaagaaacgctttta
tctggtcagcgaaaccttgcggcatctctgcagtggcgagatgcttatttggatcctatc
aactatatccaaatcgagctgttgaagcgtgctagacaacaaaatgaagatacgacagat
aaccacaaagatggcgatctcaatgtagaagacccattaatccgtagtattaacgcactg
gcagcgggtttacgtaatacggggtaa

DBGET integrated database retrieval system