KEGG   Psychrobacter sp. AntiMn-1: AOT82_481Help
Entry
AOT82_481         CDS       T04964                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
psya  Psychrobacter sp. AntiMn-1
Pathway
psya00061  Fatty acid biosynthesis
psya00780  Biotin metabolism
psya01100  Metabolic pathways
psya01130  Biosynthesis of antibiotics
psya01212  Fatty acid metabolism
Module
psya_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:psya00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AOT82_481
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AOT82_481
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    AOT82_481
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:psya01004]
    AOT82_481
Enzymes [BR:psya01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     AOT82_481
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     AOT82_481
Lipid biosynthesis proteins [BR:psya01004]
 Fatty acid synthase
  Component type
   AOT82_481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Acetyltransf_1 ClpS
Motif
Other DBs
NCBI-ProteinID: AOY42860
UniProt: A0A1D9CWD2
LinkDB All DBs
Position
complement(557125..557934)
Genome map
AA seq 269 aa AA seqDB search
MLLQGQRFVVTGIASKLSIAWAIAEALHREGASLILTYPNDKIKKRVDMAAEQFEADLVL
ECDVASDESIAACFEQVTAHWGDGIDGVVHAIGFAPMDQLDGDFVSATTREGSHIAHDIS
SYSFVALAKAARELLAMRHGSMLTLTYEGSISVLPNYNVMGMAKASLEASVRYLATSMGG
DGIRVNAISAGPIRTLAASGIKSFRKMLDISEKIAPLQRNVNQMEVGNAALFLLSPWASG
ITGEIMFVDAGFNTVAISEQLMMLDEPAQ
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgctattgcaaggacaacgatttgtcgtaactggcatcgcaagtaaactctctatcgct
tgggctattgcagaagcgctacatcgcgaaggcgcctcactgatcctgacttatccgaat
gataaaatcaaaaagcgtgtggacatggctgccgaacagttcgaagcggatttggtgcta
gagtgtgatgtcgcctctgatgagtcgattgctgcttgttttgagcaagtaaccgcgcat
tggggtgatggtattgatggtgtggtacacgccattggttttgccccaatggatcagctc
gatggtgactttgtgagtgccaccacgcgtgaaggcagccacatagcacatgatatctct
agctacagctttgtggcattggcaaaagcagctcgtgagttgcttgcaatgcgtcatggt
tctatgctgacattaacttatgaaggcagtatctcagtattgccaaactacaatgtcatg
ggtatggcaaaagccagtcttgaagccagcgtgcgctacttagcgacttctatgggcggc
gacggtatccgtgtcaatgcgatctcagcaggtccaattcgtacgctagctgctagtggc
atcaaatcattccgtaaaatgctcgatatcagcgaaaaaatcgcaccactacaacgtaat
gtcaatcagatggaagtaggtaacgcagcactattcctattatctccgtgggcatctggt
atcacgggtgagatcatgtttgttgatgcaggctttaataccgtcgctatcagtgagcag
ttgatgatgctggatgagccagcgcaataa

DBGET integrated database retrieval system