KEGG   Psychrobacter sp. DAB_AL43B: DABAL43B_1139Help
Entry
DABAL43B_1139     CDS       T04748                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
psyc  Psychrobacter sp. DAB_AL43B
Pathway
psyc00071  Fatty acid degradation
psyc00280  Valine, leucine and isoleucine degradation
psyc00281  Geraniol degradation
psyc00310  Lysine degradation
psyc00362  Benzoate degradation
psyc00380  Tryptophan metabolism
psyc00410  beta-Alanine metabolism
psyc00640  Propanoate metabolism
psyc00650  Butanoate metabolism
psyc00903  Limonene and pinene degradation
psyc00930  Caprolactam degradation
psyc01100  Metabolic pathways
psyc01110  Biosynthesis of secondary metabolites
psyc01120  Microbial metabolism in diverse environments
psyc01130  Biosynthesis of antibiotics
psyc01200  Carbon metabolism
psyc01212  Fatty acid metabolism
Module
psyc_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:psyc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    DABAL43B_1139
   00650 Butanoate metabolism
    DABAL43B_1139
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DABAL43B_1139
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DABAL43B_1139
   00310 Lysine degradation
    DABAL43B_1139
   00380 Tryptophan metabolism
    DABAL43B_1139
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DABAL43B_1139
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    DABAL43B_1139
   00281 Geraniol degradation
    DABAL43B_1139
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DABAL43B_1139
   00930 Caprolactam degradation
    DABAL43B_1139
Enzymes [BR:psyc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     DABAL43B_1139
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     DABAL43B_1139
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     DABAL43B_1139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 2-Hacid_dh_C DAO NAD_binding_8 NAD_binding_2 AlaDh_PNT_C F420_oxidored Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: SLJ84336
UniProt: A0A1U6GLI1
LinkDB All DBs
Position
I:1314148..1316319
Genome map
AA seq 723 aa AA seqDB search
MNTNSVNAINALNHFSAESDNGIITVIIDQADRKMNVIGDGFTDSFAKMTDSFINDASAK
GLILTSGKETFVVGADIDQLASIQTAEQAFDLVEDLKASMRKLELSGKPVVAAMTGTALG
GGLELALACHYRIAIDSPKTKLGLPEVKLGLLPGGGGTQRLPRLVGIQAALELMTQGKEL
RPAAAKDMGLIDAVATDKVDMLKQAKDWIIANPTAQQPWDKKGFQIPGGDSKNPKIVPIF
SIAPAMANQKSHGNYPAITHIMSCVFEGCMVDIDTGLEIESRYFVGCVLSAESKNMINTL
WIQLNSIKKGQSRPDGFERYKTKKVGILGAGMMGAGIAYVSAKAGIEVVLLDTAIEGAEK
GKNYSTKLLDKAISRGRSTEEKKQALLDKIKTTVSYDDLEGCDLIIEAVFEDVDIKAECT
RKSEAVIPETAVYASNTSTLPITELAKASIRPNQFIGLHFFSPVDKMPLVEIIVGEDTDE
ATLAKSFDYVGQISKTPIVVNDSRGFYTSRVFGTYVSEGIAMLSEGIHPRSIEVAGMKSG
MPMPPLALQDEVSLSLSLHVMQQAKRALEAEGETFTPHPAMPVVEKMVNEFGREGKKVAK
GFYDYPENAEKRLWPELTELYPTKDEQPSQQDLVDRLLYVQANETAKCFEENVVRTVADA
NIGSIFGWGFAPNQGGTLQFINSVGVKKFVERSRELASKYGERFEPAQILVKMAEKGEEF
VDG
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgaacacaaatagcgtaaatgccatcaatgcattgaaccacttttctgccgaatctgat
aatggcatcatcacggttattatcgatcaagcagaccgtaaaatgaatgtcatcggtgat
ggctttacagactcctttgctaagatgaccgatagctttatcaacgatgcgtctgccaaa
ggtttgattttaacctctggtaaagaaacctttgtcgtcggtgccgatattgaccaattg
gctagtatccaaactgctgagcaagcgtttgacttggttgaggatctaaaagccagtatg
cgtaaactggagttatctggtaagccagtcgtcgctgctatgactggcactgcgctcggt
ggtggtttagagttggccttggcctgtcattatcgtatagcgattgattctcctaaaacc
aaactgggtctacctgaagttaagttgggtctgctaccgggcggtgggggtactcagcgt
ttaccgcgcttggttggtattcaagcggcattagagcttatgactcaaggtaaagagctg
cgtccagctgctgctaaagatatgggtctgattgatgccgttgccactgataaagtagat
atgctaaagcaggccaaagactggatcatagccaatcctactgcgcagcaaccgtgggat
aagaaaggctttcaaatcccaggtggtgatagcaaaaaccctaaaatagtaccgatattc
tctattgcacccgcgatggccaaccaaaagtcgcatggcaactatcctgcgatcacccac
attatgtcttgtgtatttgaaggatgcatggtcgatattgataccggtcttgagatcgag
tcacgctactttgtcggctgtgtgctctcagctgaatctaaaaatatgatcaacaccctt
tggatacagcttaatagcatcaaaaaaggccaatcacgacctgatggttttgagcgctat
aaaactaaaaaagtcggtattctcggtgctggcatgatgggggcaggtatcgcttatgtc
tcagccaaagcgggcatagaagtggttcttttagatacggctatcgaaggcgctgaaaaa
ggcaaaaattattctactaagttgttagacaaggctatcagccgtggtcgctctactgaa
gagaaaaagcaagcgttattagataaaatcaaaacgacggtgtcttatgatgatctagaa
ggctgtgatttaattatcgaagcagtcttcgaagatgtagacatcaaagcagaatgtact
cgtaagtctgaagcggttataccagaaactgctgtttatgcatcaaatacatcgacgctg
cctattaccgagcttgcgaaagccagcatacgtccaaaccagttcatcggtctgcatttc
ttctcgccagttgataagatgccgttggttgagattatcgttggtgaagatactgatgag
gcaaccttagccaaaagctttgactatgtcggtcagatatctaaaacgccaatcgtcgtc
aacgatagccgcggtttttacacctctcgtgtatttggtacttatgtctcagaaggtatt
gcgatgctaagtgaagggatacatccacgcagcatcgaagtggctggtatgaaatctggc
atgcccatgccgccactggcgttacaagatgaagtatcgctcagcctgtcattacatgtt
atgcaacaagctaagcgagcactagaagctgaaggtgaaacgttcacaccacatcctgca
atgccagtggttgaaaaaatggtcaatgaatttggccgtgaaggtaagaaagtcgctaaa
ggcttctatgattaccctgaaaatgctgaaaaacgtttatggcctgagcttactgaactg
tatccaactaaagatgagcaaccgtcgcagcaagacttagtagaccgtttgttatacgtt
caagcgaatgagaccgcgaaatgcttcgaggagaatgtcgtacgtacagtagcggatgcc
aacatcggctctatcttcggctggggttttgcacctaaccaaggtggtacgttgcagttt
atcaactcagtaggcgttaaaaagtttgtagagcgtagccgcgagcttgctagcaagtac
ggcgagcgttttgaaccagctcagattcttgtgaaaatggccgaaaagggcgaggagttt
gtcgatggctaa

DBGET integrated database retrieval system