KEGG   Psychrobacter sp. DAB_AL43B: DABAL43B_1543Help
Entry
DABAL43B_1543     CDS       T04748                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
psyc  Psychrobacter sp. DAB_AL43B
Pathway
psyc00620  Pyruvate metabolism
psyc00680  Methane metabolism
psyc01100  Metabolic pathways
psyc01120  Microbial metabolism in diverse environments
psyc01200  Carbon metabolism
Module
psyc_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:psyc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    DABAL43B_1543 (ppc)
  Energy metabolism
   00680 Methane metabolism
    DABAL43B_1543 (ppc)
Enzymes [BR:psyc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     DABAL43B_1543 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: SLJ84738
UniProt: A0A1U6GMM5
LinkDB All DBs
Position
I:complement(1764895..1767690)
Genome map
AA seq 931 aa AA seqDB search
MTIDNDVLRERISLLGSFLGDAISRQTGEQTLHTIETLRTGFIQQRRAPNEANKQQLIDF
IASLDNQTLKNVIRSFSIYFFLANLSEENYLREQRQAMRMQSDQSWEGSFRRTLLECRER
NIEPAQMQELIEQLKFIPVFTAHPTEARRRTTMNLLQSLFTHSDALNNLPENSFAYQQAK
EQTAQTIDLLWSSDEVRTRKPLVYDEINNGLHYFNASLFNAIPKVYRNIKDAIVDIYPEL
IDYPLPAFISFGSWIGGDRDGNPFVTHDTTEMAVLMHANAVLRHYQVLLKKLRRQLIHSD
TIVPIEPEVYAKIESYIELDRRVFDYNLDDYGNEPYRRLLSIILAKIKATNRHIQSKGTD
PEAAQDAYANPQELLEDLRIIRKSVNTHDKAHGEGLLLDMIRLVKTCGFHLAALDIRQES
SYHSEVIADIFANASNLPDYQALSETERQQWLTRLLEKPGTPLIYTDNLSDKTREQLALM
HSVATLRKLVGQDTFGSYVISMTNNASQLLEVLLLMRFAGLCKIDDKGQLSADLPVAPLF
ETIEDLKNIDKILPAVLDNPLYRGLLQHSDNTQEIMLGYSDSSKDGGIITSAWQLYSAQQ
TINRIADEYGIKTRLFHGRGGSVSRGGGSTHKAIAAQPAGTLHGQIKVTEQGEVLYAKYA
NTDTAVFELTMGITGTLKACSSRFVVQPPELPNYEALFARLADAGEQRYRQLTDHTEGFY
QFYSQATPVAEISLLNIGSRPAHRNKGLPSKTTLRAIPWVFGWSLARFTLPAWYGVGSAL
HSVIDDEALMKEMNDCWPFFNVFISNIEMAFTKSDMSIAQAYSQLCEDEGLRKKIMQAVI
DEHQLTCSGLNSLLNQTSLLAHQQNLAASLEWRNAYLDPTNYIQIELLKRARQKEAKSDV
NHGDLNHGDLAVEDPLIRSINALAAGLRNTG
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atgactatcgataacgacgtactacgcgaacgcatcagcttattaggatcattcctaggg
gatgcaatttctcggcaaacgggcgaacaaacgctccatacgattgaaaccctgcgcaca
ggctttatccaacaacgccgcgcgcctaacgaagcgaacaagcaacaacttatcgacttc
atagcctcgttagacaatcaaaccttaaaaaatgtcatacgtagcttttctatctatttc
ttcttagccaatctaagtgaagaaaactacttacgagagcagcgtcaagccatgcgtatg
caatccgatcaaagctgggaaggctcgtttcgccgcaccttgctagagtgccgtgaacgc
aatattgagccggcacaaatgcaagagctgattgaacagctaaaatttatcccggtattt
accgcccatcctactgaagcgcgtcgccgtacgacgatgaatctattacagagtctcttt
acgcatagcgatgctttgaacaatcttcctgaaaacagttttgcctatcagcaagcgaaa
gaacaaacggcgcaaaccattgatttattatggtcatcggatgaagtacgtacgcgtaag
cctttagtctatgacgagatcaataatggtttacactatttcaatgccagtttattcaac
gccattcccaaggtttatcgcaatattaaagatgccattgttgatatctatcctgagcta
atagactatccactacctgctttcataagctttggctcttggatcggtggcgacagagat
ggcaatccctttgtcactcatgacaccacagaaatggcagtgctgatgcatgccaatgcc
gttttgcgccactaccaagtcctgctcaagaaactccgtcgccaactgattcatagcgat
acgattgttcctatcgaacctgaagtatatgcaaagattgaaagttacattgagctcgat
agacgagtctttgattacaatcttgatgattatggcaatgagccgtaccgaaggctgtta
tcgattatccttgccaaaataaaagcgaccaatcgtcacattcaaagtaaaggtacagat
cctgaagctgcacaagatgcttacgccaacccacaagagctattagaagatttacgcatc
atccgaaaaagcgtgaatactcatgacaaagcacatggcgaaggcttattgctagatatg
attcgtctggtcaaaacctgtggttttcatctagcagcgctcgatattcgccaagagtcg
tcttatcatagcgaggtgatagctgatatttttgccaatgcctctaatttgccagactat
caagcccttagtgaaaccgagcgccaacaatggttaacgcgcttacttgaaaagccgggc
acaccacttatttacaccgataacttgagtgataaaacacgcgaacaattggctttgatg
cactctgtggccacattacgtaaactggtcggacaagatactttcggcagttatgttatt
tcgatgaccaacaacgccagtcagttattggaagttttactattaatgcgctttgcaggc
ttatgtaagattgatgataaggggcaattatctgctgatttacccgtcgcacccttgttt
gagacgattgaagaccttaaaaacatcgataagatcctacctgcagttttagataatccg
ctataccgagggttgctacaacactcagataacacccaagaaatcatgttaggttattca
gattcatcaaaagacggcggtatcattacttctgcatggcagctttatagcgcgcagcaa
accattaaccgtatcgccgatgaatatggcatcaaaacccgcttgtttcatggtcgtggt
ggctctgtcagtcgtggtggtggctcaacgcataaagcgattgccgctcagccagccggt
acactgcatggacaaattaaagtaaccgagcaaggtgaagttctttatgctaaatatgcc
aacaccgatactgcagtgtttgagctaaccatgggcatcactggtacgcttaaagcttgt
tcctcaaggtttgtagtacaaccgcctgaattaccaaattatgaagcgctctttgcgcgt
ttagcagacgctggtgagcagcgttaccgtcagctgactgatcataccgaaggcttttat
caattctactcacaagccacgccagtggcagaaatctctttattaaatatcggctcacgc
ccagcgcaccgtaataagggtttgccaagtaagacgaccttgcgcgcaattccttgggta
tttggttggtcactagcacgctttacactgcctgcttggtatggtgtcggcagtgcttta
catagcgtcatcgatgatgaagcattgatgaaggagatgaatgactgctggccattcttt
aacgtgttcattagcaatattgaaatggcttttaccaaatctgatatgagtattgctcag
gcttatagccagctatgtgaagatgagggattacgtaaaaagattatgcaagcggtaatc
gatgaacaccagctcacctgttcaggtttaaattctttgcttaaccagacatcattattg
gctcatcagcagaatcttgcggcttctcttgaatggcggaacgcttatttagatccaacc
aactatatccaaatagagctactaaaacgtgccagacaaaaagaggctaaaagtgatgtg
aaccatggtgaccttaatcatggtgatcttgccgttgaagatccattgatccgtagtatc
aatgcgttggcagcgggtctacgtaatacggggtaa

DBGET integrated database retrieval system