KEGG   Psychrobacter sp. DAB_AL43B: DABAL43B_1984Help
Entry
DABAL43B_1984     CDS       T04748                                 

Gene name
fabZ
Definition
(GenBank) (3R)-hydroxymyristoyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
psyc  Psychrobacter sp. DAB_AL43B
Pathway
psyc00061  Fatty acid biosynthesis
psyc00780  Biotin metabolism
psyc01100  Metabolic pathways
psyc01212  Fatty acid metabolism
Module
psyc_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:psyc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DABAL43B_1984 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    DABAL43B_1984 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:psyc01004]
    DABAL43B_1984 (fabZ)
Enzymes [BR:psyc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     DABAL43B_1984 (fabZ)
Lipid biosynthesis proteins [BR:psyc01004]
 Fatty acid synthase
  Component type
   DABAL43B_1984 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas YcgR_2
Motif
Other DBs
NCBI-ProteinID: SLJ85176
UniProt: A0A1U6GNV3
LinkDB All DBs
Position
I:complement(2323544..2324053)
Genome map
AA seq 169 aa AA seqDB search
MSSTDIDTPTDEDIKSLAEQGLTLPLTYHTLKHYLPHRYPFLLVDKVISCKPGECITGIK
NVTINEEFFNGHFPGEPIMPGVLMVECMAQVSGVLGFISAGLTAEDGYLYLFAGVDKVRF
KRRVIPGDQLIIRAKTVMQKQGIYKFDCTVHVEDELAASAQVMIARQEQ
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcactgatattgataccccaactgatgaagacatcaaaagcttggctgaacaa
ggcttaacgttgccattaacctatcatacattaaagcattacttgccccatcgttatcca
tttttgcttgtagacaaggtgatttcctgtaaacctggtgagtgcattacaggtatcaaa
aatgtgaccattaatgaagagttctttaatgggcattttcctggtgagccgattatgcca
ggtgtattgatggttgagtgcatggcgcaggtttcaggcgtactagggtttattagtgcg
ggattgacggcagaagatggttatttgtatctgtttgcaggggtcgataaagtacgcttt
aagcgtcgcgtcatccctggcgatcaactgattatccgtgccaaaaccgtgatgcaaaag
caaggtatttataagttcgattgtacggtacacgttgaagatgagcttgccgccagtgct
caggttatgattgcccgtcaggagcaataa

DBGET integrated database retrieval system