KEGG   Psychrobacter sp. DAB_AL43B: DABAL43B_2119Help
Entry
DABAL43B_2119     CDS       T04748                                 

Gene name
adh
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
psyc  Psychrobacter sp. DAB_AL43B
Pathway
psyc00010  Glycolysis / Gluconeogenesis
psyc00071  Fatty acid degradation
psyc00350  Tyrosine metabolism
psyc00625  Chloroalkane and chloroalkene degradation
psyc00626  Naphthalene degradation
psyc01100  Metabolic pathways
psyc01110  Biosynthesis of secondary metabolites
psyc01120  Microbial metabolism in diverse environments
psyc01130  Biosynthesis of antibiotics
psyc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:psyc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DABAL43B_2119 (adh)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DABAL43B_2119 (adh)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    DABAL43B_2119 (adh)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DABAL43B_2119 (adh)
   00626 Naphthalene degradation
    DABAL43B_2119 (adh)
Enzymes [BR:psyc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DABAL43B_2119 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C TrkA_N adh_short
Motif
Other DBs
NCBI-ProteinID: SLJ85305
UniProt: A0A1U6GP60
LinkDB All DBs
Position
I:2491114..2492142
Genome map
AA seq 342 aa AA seqDB search
MSDKMKAAVLHEFGQPLQIEEVDIPTPGAGEIVVKMQASGVCHTDLHAIEGDWPVKPSPP
FIPGHEGVGLITAVGEGVTHVKEGDRVGVPWLYSACGHCTHCLGGWETLCEKQQNSGYSI
NGSFAEYVLANANYVGIIPESVDSVEIAPVLCAGVTVYKGLKMTDTKPGDWVVISGIGGL
GHMAVQYAIAMGLNVAAVDIDDDKLAFAKKLGAKVTVNAKNTDPAEYLQKEIGGAHGALV
TAVSAKAFDQALGMLRRGGTLVCNGLPTGEFPVSIFDTVLNGITIRGSIVGTRLDLQESL
DMAAAGKVKATVAAEPLENINDIFERMRNGKIEGRIVIDYSM
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagtgataaaatgaaagcggccgttttacatgagttcggacaaccattacagattgaa
gaagtagatattccgacaccaggtgctggtgaaattgtggtcaagatgcaagcatcaggc
gtttgtcatactgacttacatgccattgaaggagactggccagtaaaacctagcccacca
tttattcctggacatgaaggcgtaggcttgataaccgctgttggcgaaggcgttacccac
gtcaaagaaggcgaccgcgtcggggttccttggttgtactctgcctgtggccactgtacg
cattgtctaggcggctgggaaaccttatgcgagaagcagcaaaattctggctattcgatt
aacggtagttttgcagaatatgttctagccaatgcaaactatgtcggcattattcctgaa
agcgttgactctgttgagattgcacccgttttatgtgcaggtgtcactgtctataaaggt
cttaaaatgaccgacaccaagccaggcgattgggtcgtcatttccggtatcggcggacta
ggtcatatggcagttcaatatgccatcgcgatgggtctcaacgtggctgcggtcgatatt
gatgatgataaacttgcatttgctaaaaaactgggcgcaaaagtcactgttaatgcaaaa
aacactgaccctgctgagtatctacaaaaagaaataggcggtgctcatggtgcactagtg
acagcagtatctgcaaaagcttttgatcaagcgcttggcatgttacgacgcggcggtact
ttggtttgtaatggtctaccaaccggtgagttcccagtatcaatttttgatactgttttg
aacgggattactattcgtggctcgatcgttggtactcgtctcgacttacaagagtcgcta
gatatggcggcggcaggcaaggtaaaagccacagttgccgctgaaccacttgagaatatc
aatgatatctttgaacgtatgcgtaatggtaaaattgaaggtcgcatcgtcattgactat
agcatgtag

DBGET integrated database retrieval system