KEGG   Psychrobacter sp. DAB_AL43B: DABAL43B_2341Help
Entry
DABAL43B_2341     CDS       T04748                                 

Gene name
mdh
Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
psyc  Psychrobacter sp. DAB_AL43B
Pathway
psyc00020  Citrate cycle (TCA cycle)
psyc00270  Cysteine and methionine metabolism
psyc00620  Pyruvate metabolism
psyc00630  Glyoxylate and dicarboxylate metabolism
psyc00680  Methane metabolism
psyc01100  Metabolic pathways
psyc01110  Biosynthesis of secondary metabolites
psyc01120  Microbial metabolism in diverse environments
psyc01130  Biosynthesis of antibiotics
psyc01200  Carbon metabolism
Module
psyc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psyc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
psyc_M00012  Glyoxylate cycle
psyc_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:psyc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DABAL43B_2341 (mdh)
   00620 Pyruvate metabolism
    DABAL43B_2341 (mdh)
   00630 Glyoxylate and dicarboxylate metabolism
    DABAL43B_2341 (mdh)
  09102 Energy metabolism
   00680 Methane metabolism
    DABAL43B_2341 (mdh)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    DABAL43B_2341 (mdh)
Enzymes [BR:psyc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     DABAL43B_2341 (mdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: SLJ85526
UniProt: A0A1U6GPU1
LinkDB All DBs
Position
I:complement(2745198..2746181)
Genome map
AA seq 327 aa AA seqDB search
MKQPVRVAVTGAAGNISYAMLFRIASGEMLGKDQPVILQLLEIAPALDALKGVVMELEDC
AFPLLAGIVQTDDATVAFKDIDYALLVGSRPRGPGMERKDLLEANAAIFSAQGKALNDVA
SRDVKVLVVGNPANTNAVIAQRNAPDLDPRNFTAMTRLDHNRAMAQLAGKTDSTINDVKK
MIIWGNHSSTQYPDLTACTVNGKPALDLVDREWYEATYIPEVQQRGAAIIKARGASSAAS
AANAAIAHVRTWVMGTDDNDWVSMGVYSNGEYGISEGLIYSFPCTCKDGDWSIVADVDVS
SAFSKEKMAATEQELNEERDAVAHLLP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacctgtacgtgttgccgtaactggtgctgctggtaatatcagctatgctatg
ttatttcgtattgcatctggtgaaatgctaggtaaagatcagccagtaatcttgcaatta
cttgaaatcgctccagcactagacgccttaaagggtgtggtcatggaattagaagactgt
gcatttcctttgttggcaggtatcgtacaaactgatgatgccactgttgcgtttaaagat
atcgactatgctttactagtaggctcacgtcctcgtggcccaggtatggaacgtaaagac
ttgctagaagccaacgctgcgattttctcagcgcaaggtaaagcattgaatgacgttgct
agccgtgatgttaaagtattggtagtaggtaaccctgctaataccaacgctgttattgct
cagcgtaatgcaccagatttagacccacgtaactttactgcgatgactcgtttggatcat
aaccgcgcaatggcacagttagcaggtaaaactgacagcaccattaatgacgtgaaaaaa
atgatcatttggggcaaccattcatcaactcagtaccctgatctaacggcttgcaccgta
aacggtaagcctgcattagatttagtagatcgcgaatggtatgaagcgacttatatccca
gaagtacaacaacgcggtgcggcaatcattaaagctcgtggtgcctcttctgcagcctct
gctgcaaacgctgctattgcacacgtacgtacgtgggtaatgggtactgatgataacgat
tgggtctctatgggtgtctactctaatggcgagtatggtatctctgaaggcttgatttac
tcattcccatgtacttgtaaagatggcgactggtctatcgttgctgacgttgatgtgtct
tcagctttctcaaaagagaaaatggcagctactgagcaagagcttaatgaagagcgtgac
gcagtagcacacttactaccataa

DBGET integrated database retrieval system