KEGG   Psychrobacter sp. DAB_AL43B: DABAL43B_2376Help
Entry
DABAL43B_2376     CDS       T04748                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
psyc  Psychrobacter sp. DAB_AL43B
Brite
KEGG Orthology (KO) [BR:psyc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DABAL43B_2376 (ahpF)
Enzymes [BR:psyc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DABAL43B_2376 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox HI0933_like GIDA Thioredoxin_3 FAD_binding_2 NAD_binding_8 Thi4 FAD_oxidored K_oxygenase AlaDh_PNT_C DAO NAD_binding_7 FAD_binding_3 Glutaredoxin Shikimate_DH Thioredoxin_4 3HCDH_N Lycopene_cycl HlyD DSBA Thioredoxin_14
Motif
Other DBs
NCBI-ProteinID: SLJ85560
UniProt: A0A1U6GQ38
LinkDB All DBs
Position
I:complement(2779714..2781291)
Genome map
AA seq 525 aa AA seqDB search
MIDKSLLDAVKSYSENMTRPITFVLGSGEHSKRAELIDFLTKIAGTTDKINFDSTVTDDS
LPSPISFAVRSHIDGGLTDTGIVFSGIPGGHEFTSLILAILQAGGHTLKLDDGIQKLIKR
FNKPLQFQTYVSLSCHSCPEVVQALNQFALLNDDISNEMIDGALFQEQVEANNIQGVPAV
FLNGKPFANGLIDTAKLIEKLQEQFPDLLAEADDDAEQLEQQDVTIIGAGPAGIAAAIYT
ARKGLKVTMVADRIGGQVKDTQDIENLISVPLTTGGELSANFEKHLREYNITLKEHVSVK
EIGETADENYSIHLNTGETFETRSIILATGAQWRKLGVPGEEENIGKGVAFCAHCDGPFF
KGKDISVIGGGNSGIEAAIDLAGIVKHVTVFEFADELKADQVLINKAKEKANIDIITSAA
TQEIKATDGKVTSIVYQDRNSSENKELDVSAVFVQIGLVPNTEFVKGFVDLNRFGEIEID
ERCRTDRKGIFACGDVTTVPFKQINIAMGEGSKAALSAFEYLVMQ
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgatagataaaagcttattagacgcagtcaaaagttatagtgaaaatatgacccgccca
attacctttgtattgggtagtggtgaacatagcaagcgtgctgagttgattgattttttg
actaaaattgcaggtacgacagataaaataaattttgatagtacagtaaccgatgacagc
ttaccaagtccaatcagctttgcggttcgcagtcatattgatggcggattgaccgacact
ggtatcgtctttagtggtatcccgggcggtcatgaatttacatcgctcatattggcaatc
ttgcaagcgggcggtcacacgctgaaactagatgacggtattcaaaaactcatcaagcgt
tttaataaaccgctacagttccaaacttacgtgtcgttgtcttgccacagctgcccagaa
gtcgtacaagcgctgaaccaattcgcgctactaaatgatgacatcagcaatgagatgatc
gatggcgcattgttccaagagcaagtagaagccaataacatccaaggcgtaccagcagta
tttttaaacggtaagccgtttgctaatggtctgattgacacggctaaattgattgagaag
ttgcaagagcagttccctgatttgttagcagaagctgacgatgacgctgagcagttagag
cagcaagatgtgacgattattggcgctggtcctgcaggtattgcggctgctatttatact
gcgcgtaaaggtttaaaagtgaccatggttgctgaccgtattggtggtcaggtaaaagat
acccaagatatcgaaaacttaatttctgtgcctttaacgacaggtggcgagctatctgca
aactttgaaaagcatttgcgtgaatataatatcacgcttaaagagcacgtcagtgtcaaa
gagattggtgagactgctgatgaaaattacagcattcatctaaatactggtgagacattt
gagacgcgcagcattatcttagcgactggtgctcagtggcgtaagcttggtgtccctggt
gaagaagaaaacattggtaaaggcgtggcgttctgtgctcactgtgatggtccgttcttt
aaaggaaaagacatctcggtgatcggtggcggtaactcaggtatagaagcggcgattgat
ttagccggtatcgtgaagcatgtgacggtattcgagtttgctgatgagctaaaagccgat
caagtattgattaataaagccaaagaaaaggcaaatattgatatcatcactagtgcagcc
actcaagagattaaagcgactgatggtaaagtgacttctatcgtttatcaagatcgcaat
agcagtgagaataaagagcttgatgtttcggctgtttttgtccaaattggcttggtgcca
aacactgaatttgtcaaaggctttgtcgatttaaaccgctttggcgagattgagattgat
gagcgctgccgcacggatcgcaaaggtatttttgcttgtggtgacgtcacgaccgtaccc
tttaagcagattaatattgcgatgggtgaaggtagtaaagcggcattatcagcgtttgaa
tatttagtaatgcagtaa

DBGET integrated database retrieval system