KEGG   Psychrobacter sp. DAB_AL43B: DABAL43B_2542Help
Entry
DABAL43B_2542     CDS       T04748                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase, Fe-Mn family
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
psyc  Psychrobacter sp. DAB_AL43B
Brite
Enzymes [BR:psyc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     DABAL43B_2542 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: SLJ85725
UniProt: A0A1U6GQD0
LinkDB All DBs
Position
I:complement(2979523..2980152)
Genome map
AA seq 209 aa AA seqDB search
MSNVTLPNLPYAKDALEPHISAETLEYHHDKHHAAYVNKLNELLPGSGLEDKTLSEIIVA
TAKDDSKQGMFNQAAQVWNHTFYWNCMTPDNGGGEPTGDLKAKIEEDFGSYDKFREEFKN
AAMTQFGSGWAWLVADKVGGKLSIAKTANADTPLAHDQVAVLTCDVWEHAYYIDYRNRRP
DYVDTFLDKLVNWDYANAKYKGQDAGVEE
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacgttactttaccaaacctaccatatgcaaaagacgcgcttgagccacatatc
agtgccgagacgttagaataccatcatgataagcatcatgctgcttatgtgaacaaattg
aacgaattgctaccaggttctggtctagaagacaaaactttgtcagaaatcatcgtcgca
actgcgaaagatgacagcaaacaaggtatgtttaaccaagcagcccaagtatggaaccac
acgttctattggaactgcatgacgccagacaacggcggcggcgaacctactggtgatcta
aaagctaaaatcgaagaagatttcggtagctatgataagttccgtgaagagttcaaaaac
gcagcaatgactcagttcggttcaggttgggcatggttagttgctgataaagttggcggc
aaactgtctatcgctaaaactgctaacgctgatacgccacttgcacatgaccaagtagcg
gtattgacttgtgacgtatgggaacatgcttactacatcgattatcgtaaccgtcgtcct
gactatgttgatacgttcctagacaagcttgtgaactgggactatgcaaatgcgaaatat
aaaggtcaagatgctggcgttgaagagtaa

DBGET integrated database retrieval system