KEGG   Psychrobacter sp. P11G5: AK825_02815Help
Entry
AK825_02815       CDS       T04411                                 

Gene name
gatB
Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
psyg  Psychrobacter sp. P11G5
Pathway
psyg00970  Aminoacyl-tRNA biosynthesis
psyg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psyg00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AK825_02815 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:psyg03029]
    AK825_02815 (gatB)
Enzymes [BR:psyg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AK825_02815 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AK825_02815 (gatB)
Mitochondrial biogenesis [BR:psyg03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AK825_02815 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AMN66782
UniProt: A0A127GX17
LinkDB All DBs
Position
complement(670600..672129)
Genome map
AA seq 509 aa AA seqDB search
MNTATTTDNNAVRKHAVRKELFVDGYEVVIGIEIHCQLNTESKIFSSAPTDFGHEPNSQA
SIVDLGLPGVLPVLNAGVVDRALKFGIGVNAELGLFNTFDRKNYFYPDLPKGYQITQMAN
PIVGEGYIDVIVNEGEKNEYPKRMGITRAHLEEDAGKSVHDAVDGMTGVDLNRAGTPLIE
IVSEPDMRSAHEALAYIKAIHQLVTWLGISDAVMAEGSFRCDCNVSVRKPGAELGTRTEL
KNLNSFRFIERAINREIERQIDIIEDGGKVIQATMLYDPERDETRTMRTKEDANDYRYFP
DPDLLPVRIEQHTVDAIKAAMPELPVARRARFEEALGLSEYDARILTGSRQLADYFEDVV
AEVGQQDAKMAANWVMGDLLGALNKDDKDIIDSPISAKQLAGMLERIKDDTLSGKLAKKV
FSALYEREGGNDDDAADKIIEEKGLKQETDTGAIKAIVEEVIAKNQPMVEEYRGGKEKAF
NGLVGQVMKASRGSANPQQVNQILKELLG
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaacacagcaactactactgataacaatgccgtccgcaaacacgctgttcgtaaagag
ctattcgtcgatggttatgaagtagtcatcggtatcgaaatccactgccagctgaataca
gagagtaagatattctccagcgcaccgactgacttcggtcatgagccaaacagccaagcc
agtatcgtagatttaggcttgcccggtgtactaccagttctaaatgctggcgtggtcgat
cgtgcgctaaaattcgggattggtgtcaatgctgagctgggtctatttaatacctttgac
cgtaaaaactacttctaccctgacttgcctaaaggctatcaaattacccaaatggccaac
cctatcgttggcgaaggttatatcgatgtcatagtcaatgaaggcgagaaaaacgaatac
cctaaacgtatgggcatcacccgcgcgcatttagaagaagacgctggcaagtcagttcat
gatgccgtcgatggtatgactggtgtggatttgaaccgtgctggtacgccattaatcgaa
atcgtctctgagcctgatatgcgttctgctcacgaagcactggcctatatcaaagccatt
catcagctggtcacgtggttgggtatctcagatgcggtcatggcagaagggtcattccgc
tgcgactgtaacgtctctgtgcgtaagcctggcgcagaattgggtacgcgtactgaactc
aaaaacctaaactcgttccgctttatcgaacgcgccatcaatcgtgaaatcgagcgtcaa
atagatatcattgaagacggcggtaaagttatccaagcaacgatgctttatgatccagag
cgcgatgaaactcgcaccatgcgtaccaaggaagacgccaacgactatcgctatttccct
gatcctgacctgctccctgtacgtattgagcagcataccgttgatgcgattaaagcagcc
atgcctgaactacctgttgcccgacgtgcgcgttttgaagaagcgcttgggctgtcagaa
tacgacgctcgtatcttaacgggtagccgtcagcttgctgattactttgaagatgtcgtt
gccgaagtggggcaacaagatgcgaagatggcggctaactgggtcatgggcgatctgctg
ggtgcactgaataaagatgataaagacatcatcgactcccctatcagcgccaagcaattg
gctggcatgctggaacgtatcaaagatgatacgctatctggcaaattggctaagaaggtc
tttagcgccctgtatgagcgcgaaggcggcaacgatgatgatgcagcagataaaatcatc
gaagaaaaaggtcttaagcaagaaacggatacgggcgctatcaaagctatcgttgaagaa
gtcatcgcgaaaaaccaaccgatggtggaagagtatcgcggcggtaaggaaaaagctttt
aacggtctggtgggtcaagtcatgaaagccagtcgcggtagtgccaacccgcagcaagtg
aaccaaatcctaaaagaactattgggttaa

DBGET integrated database retrieval system