KEGG   Psychrobacter sp. P11G5: AK825_08080Help
Entry
AK825_08080       CDS       T04411                                 

Gene name
fabG
Definition
(GenBank) 3-ketoacyl-ACP reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
psyg  Psychrobacter sp. P11G5
Pathway
psyg00061  Fatty acid biosynthesis
psyg00780  Biotin metabolism
psyg01100  Metabolic pathways
psyg01130  Biosynthesis of antibiotics
psyg01212  Fatty acid metabolism
Module
psyg_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:psyg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AK825_08080 (fabG)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AK825_08080 (fabG)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    AK825_08080 (fabG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:psyg01004]
    AK825_08080 (fabG)
Enzymes [BR:psyg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     AK825_08080 (fabG)
Lipid biosynthesis proteins [BR:psyg01004]
 Fatty acid synthase
  Component type
   AK825_08080 (fabG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase 2-Hacid_dh_C Bac_DnaA THF_DHG_CYH_C
Motif
Other DBs
NCBI-ProteinID: AMN67667
UniProt: A0A127GZE0
LinkDB All DBs
Position
complement(1997964..1999364)
Genome map
AA seq 466 aa AA seqDB search
MSDRYGDFVQSSIGKKVAKNLGLPLPVSLDRFESGQRLVRGSVLVGSATGNDNRVSESIA
RILSELHAEVFVNSSDSIKDTLADANVEAKANTGSEDKFKVLLFDASNISNADELKQVYE
FFHFVARRVEKSGRVIIVGRPPEEITDVETALAQRALEGFVKSVGKEFKRGITAQLIYVA
EGSESNLDSTLRFFTSARSAYVSGQVVRVGKGSVVEVDWTQPLGGKTMLVTGASRGIGEA
IARVLAREGAHVICLDVPQQQADLQKVASEISGSTLMVDITSDEAGVQIAEAAEKRGGLD
SIIHNAGVTRDKTLAKMDEQKWDMVININLASIAKLNRYLLENDVLKDDARIVCVSSISG
IAGNLGQTNYATSKAGVIGLVDATAKQLVANDKGMTINAVAPGFIETQMTEAIPFAIREA
GRRMNSMSQGGLPVDVAETIAWLASPASAGLNGNTVRVCGQSLLGA
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaccgttatggtgattttgttcaatcttctattggtaaaaaagtcgctaaaaat
ttaggtttaccgctaccagtaagtctcgatcgttttgagagtggtcagcgccttgtacga
ggtagtgtattggtaggttcagctaccggcaatgataaccgcgttagcgaatctattgcc
cgtattttgtctgagctgcatgctgaagtctttgttaatagcagcgatagtattaaagat
acgcttgccgatgccaatgttgaagcaaaagccaatacaggtagcgaagataagtttaag
gtattgttgtttgatgctagcaatatcagtaatgcagatgagctaaagcaagtatacgag
ttctttcattttgtcgcacgccgcgtagagaagtcaggtcgcgtcattatcgttggtcgt
ccacctgaagagattactgatgtagagacagcactagctcaacgtgcacttgaaggcttt
gtgaagtctgtcggcaaagagtttaaacgtggtattaccgcgcagctaatctatgtcgct
gaaggctcagaaagcaatcttgattcaacattgcgcttctttacctcagcacgttcagct
tatgtatcaggacaagtagtacgtgttggcaagggtagtgtagttgaagtcgactggacg
cagcctttaggcggcaaaaccatgctagtcactggcgcaagccgtggtatcggcgaagcg
attgctcgcgttctggctcgtgaaggcgcgcatgttatctgtttagatgtaccgcaacaa
caagccgacttacaaaaagttgcaagcgagattagcggatctactttaatggttgatatc
actagcgatgaggcaggcgtacagatcgcagaagctgctgaaaagcgtggtggtctggat
tctatcattcacaatgctggcgtgactcgtgataaaacgcttgccaaaatggatgagcaa
aaatgggatatggtaattaatattaatcttgccagtattgccaagcttaatcgttactta
cttgaaaatgatgtattaaaagatgatgcgcgcatcgtttgtgtgtcttcaatctcgggt
atcgcaggcaatcttggtcagaccaactatgctacttctaaagctggggtaattggattg
gtcgatgcgactgctaaacagctagtagccaatgacaaaggtatgacgatcaatgcagtg
gctcctggttttatcgagactcaaatgactgaagccattccatttgcgattcgtgaagct
ggtcgtcgcatgaactcaatgagtcaaggtggactaccagtcgatgttgctgaaaccatc
gcatggctagcgtctcctgcgtctgctggtctcaatggcaacacggtacgtgtctgtggt
caaagcttgctcggtgcataa

DBGET integrated database retrieval system