KEGG   Psychrobacter sp. P11G5: AK825_09780Help
Entry
AK825_09780       CDS       T04411                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
psyg  Psychrobacter sp. P11G5
Pathway
psyg00010  Glycolysis / Gluconeogenesis
psyg00071  Fatty acid degradation
psyg00350  Tyrosine metabolism
psyg00625  Chloroalkane and chloroalkene degradation
psyg00626  Naphthalene degradation
psyg01100  Metabolic pathways
psyg01110  Biosynthesis of secondary metabolites
psyg01120  Microbial metabolism in diverse environments
psyg01130  Biosynthesis of antibiotics
psyg01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:psyg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AK825_09780
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AK825_09780
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    AK825_09780
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AK825_09780
   00626 Naphthalene degradation
    AK825_09780
Enzymes [BR:psyg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AK825_09780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C TrkA_N adh_short
Motif
Other DBs
NCBI-ProteinID: AMN68885
UniProt: A0A127H303
LinkDB All DBs
Position
2435297..2436313
Genome map
AA seq 338 aa AA seqDB search
MKAAVLHEFGQPLQIEEVDIPTPGAGQIVVKMQASGVCHTDLHAVEGDWPVKPSPPFIPG
HEGVGLITAVGENVHHVKEGDRVGVPWLYSACGHCTHCLGGWETLCLRQKNSGYSVNGSF
AEYVLADANYVGIIPEGVDSVEIAPVLCAGVTVYKGLKMTDTKPGDWVVISGIGGLGHMA
VQYAIAMGLNVAAVDIDDEKLEFAKKLGATVTVNAKNTDPGEYLQKEIGGAHGVLVTAVS
SKAFDQALTMLRRGGTLVCNGLPTGDFPVSIFDTVLNGITIRGSIVGTRLDLQESLEMAA
EGKVKATVAAEPLENINDILERMRQGKIEGRIVIDYSM
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgttttacatgagttcggacaacctttacaaattgaagaagtggacatt
ccgacccccggtgctggtcaaatcgttgtaaaaatgcaagcatcaggtgtctgtcatacc
gatttgcatgcggttgaaggagattggccagtcaaacctagcccaccatttatccccgga
cacgaaggcgtaggccttataaccgccgttggcgaaaacgtacatcatgtcaaagaaggt
gaccgagtcggtgtgccttggctctactctgcctgtggtcactgtacccattgtttgggc
ggctgggagactttatgtctacgccaaaaaaactctggctactcagtaaacggcagtttt
gcagaatatgttctagcagatgccaactatgtgggcatcattcctgagggcgttgactct
gttgagattgcaccagttttatgtgcaggtgtcacggtgtataaaggtcttaaaatgacc
gacaccaagccaggcgattgggttgtcatttcaggtatcggcggacttggtcacatggcg
gtacagtacgccattgccatgggcttgaatgttgccgctgtggatattgatgatgagaag
cttgagtttgccaaaaaactgggtgcgaccgtcactgttaatgccaaaaacaccgaccct
ggtgagtatctacaaaaagagatcggtggcgctcatggagtgctcgtgactgccgtatcc
tctaaggcatttgatcaagccttaactatgttacgacgcggtggtactttggtttgtaat
ggtctgcctactggtgattttcctgtatctatctttgacacagttctgaacggtattact
attcgcggttcaatcgtgggtacacgtcttgacttgcaagaatcgctagagatggcagca
gaaggcaaggtgaaagcaaccgttgccgctgagccgcttgagaatatcaatgacattctt
gaacgtatgcgccaaggtaaaatcgagggtcgcattgtgattgactactccatgtag

DBGET integrated database retrieval system