KEGG   Psychrobacter sp. P11G5: AK825_11665Help
Entry
AK825_11665       CDS       T04411                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
psyg  Psychrobacter sp. P11G5
Pathway
psyg00020  Citrate cycle (TCA cycle)
psyg00270  Cysteine and methionine metabolism
psyg00620  Pyruvate metabolism
psyg00630  Glyoxylate and dicarboxylate metabolism
psyg00680  Methane metabolism
psyg01100  Metabolic pathways
psyg01110  Biosynthesis of secondary metabolites
psyg01120  Microbial metabolism in diverse environments
psyg01130  Biosynthesis of antibiotics
psyg01200  Carbon metabolism
Module
psyg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psyg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
psyg_M00012  Glyoxylate cycle
psyg_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:psyg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AK825_11665
   00620 Pyruvate metabolism
    AK825_11665
   00630 Glyoxylate and dicarboxylate metabolism
    AK825_11665
  09102 Energy metabolism
   00680 Methane metabolism
    AK825_11665
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AK825_11665
Enzymes [BR:psyg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     AK825_11665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: AMN68270
UniProt: A0A127H136
LinkDB All DBs
Position
complement(2864205..2865188)
Genome map
AA seq 327 aa AA seqDB search
MKQPLRVAVTGAAGNISYAMLFRIASGEMLGKDQPVILQLLEITPALDALKGVVMELEDC
AFPLLAGIVQTDDANVAFKDIDYALLVGARPRGPGMERKDLLEANAAIFSAQGKALNDVA
SRDVKVLVVGNPANTNALIAQRNAPDLDPRNFTAMTRLDHNRAMAQLADKTDSTVNDIKN
MTIWGNHSSTQYPDLTACTVNGKPALDLVDRDWYENTYIPEVQQRGAAIIKARGASSAAS
AANAAIAHMRTWALGSDENDWVSMGVYSNGEYGIAEGLIYSFPVTCANGDWSIVDGVDVS
SDFSKEKMAATEQELSEERDAVAHLLP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagcctttacgtgttgccgtgactggtgccgctggtaatatcagctacgcgatg
ctatttcgtattgcatctggcgagatgctaggtaaagatcagccagttattttgcaatta
cttgaaatcacaccagctcttgacgccctaaagggtgtagtcatggaactagaagactgt
gcattcccattgttggccggtatcgttcaaactgatgatgctaacgttgcatttaaagat
atcgactatgcattacttgttggcgcacgtccgcgtggcccaggtatggaacgtaaagat
ttgctagaagccaatgctgcgattttctcagcacaaggtaaagcattgaacgatgttgca
agccgtgatgtaaaagtattggtcgtgggtaaccctgcgaataccaacgcgcttatcgct
cagcgtaatgcaccagatcttgacccacgtaactttactgccatgactcgcctagatcat
aaccgtgctatggcacagttagctgacaaaactgacagcactgttaatgacatcaaaaac
atgactatctggggcaaccattcatcaactcagtatccagacctaaccgcttgtaccgta
aacggtaagccagcgctagatctagtagatcgcgattggtacgaaaacacttatatccca
gaagtacaacagcgcggtgcagcgattattaaagctcgcggtgcatcatctgccgcttct
gctgccaatgctgccattgcacacatgcgcacgtgggcactaggtagtgatgaaaacgat
tgggtatcaatgggtgtttactcaaacggcgaatacggtattgctgaaggcttaatctac
tcattcccagttacctgcgctaacggcgactggtctatcgtagacggcgttgatgtgtca
tcagatttctcaaaagagaaaatggcggcgactgagcaagagcttagcgaagagcgtgat
gcagtagcacatttattaccataa

DBGET integrated database retrieval system