KEGG   Psychrobacter sp. P11G5: AK825_11895Help
Entry
AK825_11895       CDS       T04411                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
psyg  Psychrobacter sp. P11G5
Brite
KEGG Orthology (KO) [BR:psyg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AK825_11895
Enzymes [BR:psyg01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AK825_11895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like FAD_binding_2 Thioredoxin_3 NAD_binding_8 Thi4 DAO FAD_oxidored K_oxygenase AlaDh_PNT_C NAD_binding_7 Lycopene_cycl FAD_binding_3 Shikimate_DH Glutaredoxin 3HCDH_N NAD_binding_9 T4BSS_DotH_IcmK
Motif
Other DBs
NCBI-ProteinID: AMN68307
UniProt: A0A127H188
LinkDB All DBs
Position
complement(2909700..2911277)
Genome map
AA seq 525 aa AA seqDB search
MIDQSLLDAVKSYSENMTRPITFVLGSGEHKKRAELIDFLTKIAGTTDKINFDATANDDS
LPSPISFAVRSHIDGTLTDTGIVFSGIPGGHEFTSLILAILQSGGHTLKLDEGIQKLIKR
FNKPLQFQTYVSLSCHSCPEVVQALNQFALLNDDISNEMIDGALFQEQVETNNIQGVPAV
FLNGKPFANGLIDTAKLIEKLQEQFPDLLAEADDDAEQLEQQDVTIIGAGPAGIAAAIYT
ARKGLKVTMVADRIGGQVKDTQDIENLISVPLTTGNELSANFEKHLQEYNITLKEHVSVK
EISETEEENYSIHLNTGEKFETRSIILATGAQWRKLGVPGEEENIGKGVAYCAHCDGPFF
KDKDISVIGGGNSGVEAALDLAGIVKHVTVLEFADDLKADQVLINKAKEKANIEFITGAA
TQEIKATDGKVTSIVYQDRSTGETHERDLAGVFVQIGLVPNTGFIKGFVDLNRFGEIEID
ERCRTDRKGIFACGDVTTVPFKQINIAMGEGSKAALSAFEYLVMQ
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgatagatcaaagtttattagacgccgttaaaagctatagcgaaaatatgactcgtccg
attaccttcgtattgggtagcggcgagcataaaaaacgtgcagagttgattgattttttg
accaaaatcgctggtactacggataagattaattttgatgcaacagcgaatgatgatagt
ttaccaagtccgattagctttgcggtccgtagtcatattgatggcacgttgaccgatact
ggtattgtctttagcggtatcccaggtggtcatgagtttacctcgcttatcttagcaatc
ttgcagtcgggtggccatacgctaaaactagatgagggtattcaaaagctcattaagcgt
tttaataagccattgcagttccaaacttacgtgtcgctctcttgccacagttgcccagaa
gtcgtacaagcgctgaaccaattcgcgctactaaacgatgacatcagcaacgagatgatc
gatggtgcattgttccaagagcaagtagaaacgaataacatccaaggcgtaccggcagta
tttttaaacggtaagccgtttgctaatggtctgattgataccgccaagctcattgaaaag
ctacaagagcaattccctgatttattagcagaagctgacgatgatgccgagcagttagag
cagcaagatgtgactattattggtgctggtcctgctgggattgccgccgcgatttatacc
gcgcgtaaaggcttaaaagtgacgatggtcgcagatcgtatcggtggacaggtgaaagat
acacaagatatcgaaaacttaatctctgtgccattgaccacaggcaatgaattgtctgcc
aattttgaaaagcacttgcaagagtacaatatcacgctcaaagagcacgtgagtgtcaaa
gaaatcagcgagacggaagaagaaaattacagcatccatctaaacacgggtgagaagttt
gagactcgcagtattatcttagcgactggtgcgcaatggcgtaaacttggtgtaccaggt
gaagaggaaaatatcggtaaaggcgttgcctactgtgcgcactgtgacggtcctttcttt
aaagataaagacatctcagtcatcggcggcggtaactctggtgtcgaagcagcattagac
cttgcaggtatcgtgaagcatgtgaccgtacttgaattcgcagatgatttaaaagcggat
caggtattgattaacaaagccaaagaaaaagccaatattgaatttatcactggggcggcg
acgcaagagattaaagcgactgatggtaaagtgacttctattgtttatcaagatcgcagc
acaggtgagacccatgagcgtgacttggcaggggtattcgtacagattggcttagtgccg
aatactggattcattaaaggctttgtcgatttaaaccgttttggcgagattgagattgat
gagcgttgccgcaccgatcgcaaaggtatctttgcttgtggtgacgtgacaactgtgccc
tttaagcagatcaatattgcgatgggcgagggttcgaaagccgcattatcagcgtttgaa
tatttagttatgcaataa

DBGET integrated database retrieval system