KEGG   Psychrobacter sp. P11G5: AK825_12675Help
Entry
AK825_12675       CDS       T04411                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
psyg  Psychrobacter sp. P11G5
Brite
Enzymes [BR:psyg01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AK825_12675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AMN68436
UniProt: A0A127H1M5
LinkDB All DBs
Position
complement(3105194..3105823)
Genome map
AA seq 209 aa AA seqDB search
MSKITLPDLPYAKDALEPHISAETLEYHHDKHHAAYVNKLNDLLPGSGLEDKTLPEIIEA
TSKDDSKQGMFNQAAQVWNHTFYWNCMTPDNGGGEPTGDLKAKIEEDFGSYDKFREEFKN
AALTQFGSGWAWLVADKEGGKLSIAKTANADTPLAHGQVAVLTCDVWEHAYYIDYRNRRP
DYVDTFLDKLVNWDYANAKYKGQDAGVEE
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagattactttaccagacctaccttatgcaaaagacgcacttgagccgcatatc
agcgctgagacgctagaatatcatcatgataagcatcatgctgcctatgtaaacaagtta
aacgatttgctaccaggttctggtctagaagacaaaacattgccagaaatcatcgaagcg
acgtcaaaagatgacagcaagcaaggtatgtttaaccaagcagcgcaagtatggaaccac
acgttctattggaactgcatgacgccagacaatggtggtggtgagccaacaggcgatcta
aaagccaaaatcgaagaagattttggtagctatgataagttccgtgaagagtttaaaaat
gcagcgttaacacagttcggttctggttgggcctggttagttgctgataaagaaggcggc
aaactgtctatcgctaaaactgccaacgctgatacgccactggcacatggtcaagtagcg
gtattgacttgtgacgtatgggaacatgcgtattacatcgattatcgtaaccgtcgtcct
gactatgttgatacgttcctagacaagctagtgaactgggactacgcaaacgcgaaatat
aaaggtcaagatgctggcgttgaagagtaa

DBGET integrated database retrieval system