KEGG   Psychrobacillus sp. AK 1817: D0S48_12585Help
Entry
D0S48_12585       CDS       T06219                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
psyh  Psychrobacillus sp. AK 1817
Brite
KEGG Orthology (KO) [BR:psyh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    D0S48_12585
Enzymes [BR:psyh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     D0S48_12585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 FAD_binding_3 HI0933_like DAO AlaDh_PNT_C Thi4 NAD_binding_7 NAD_binding_8 Thioredoxin_4 Glutaredoxin FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: QEY21436
UniProt: A0A5J6PM54
LinkDB All DBs
Position
2529683..2531245
Genome map
AA seq 520 aa AA seqDB search
MVLDNQIKAQLQQYLALLEGDLVLKVSVGDDKVSQDTLELVTELEKMSSRISVEHVQLER
TPSFSINKAGEESGVVFAGLPLGHEFTSLVLALLQVSGRAPKVDDAVIKRIQAIKDPMHF
ETFVSLTCHNCPNVVQAFNIMAVINPNISHVMVEGGAFQDEVKAKDIMAVPSVFLNGENF
ANGRMEIEDILNKLGNRSDGSEFNDVEPFDVLVVGGGPAGASAAIYAARKGIRTGIVAER
FGGQVNDTLSIENIIGTKATEGPQFVSSLEGHVADYPIEVMKSQRVSSIVRKEQVEVVLE
NGAVLKGKTVILSTGARYRQLNVPGEEAFKNKGVAYCPHCDGPIFKGKNVAVVGGGNSGV
EAAIDLAGIVNHVTVLQHNDELKADQVLQERLHSLSNVTVLTNASTQKITGTDKVNGLTY
LDRVTGEVHHIELEGVFVQIGLLPNTEFLQGTIDLNAHGEIIIDKHGATSMPGVFAAGDC
TDTAYKQIIISMGTGATAALGAFDYMIRNIAPSNSELVKV
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggtattagacaatcaaattaaagcacaactacaacaatatttagcgttgcttgaaggc
gatcttgtattaaaggttagtgtaggtgatgataaagtatctcaagatacattagagcta
gtaacagaattagaaaagatgtcatcacgcatttcagtcgagcatgtgcaattagagcgc
acgccaagttttagtataaacaaagctggtgaggagtcaggagttgtttttgctggctta
cctttaggacatgaatttacttcattagttttggctttacttcaagtaagtggccgtgct
ccgaaagttgatgatgcagttatcaagcgtattcaagcaattaaagatccaatgcacttt
gaaactttcgtgagcttaacttgccataattgtccgaatgtagttcaagcttttaatatt
atggctgtgataaacccgaatatctcccatgtaatggttgaagggggcgcatttcaagac
gaagtaaaagctaaagatattatggctgttccatcagttttcttaaatggtgaaaatttt
gcaaacggtcgtatggaaattgaagacatattaaataaattaggaaatagatcagatgga
tctgaatttaatgatgtagaaccatttgatgttcttgttgttggtggtggtcctgcgggt
gcaagcgcagctatttatgcagcacgtaaaggaattcgaacgggaattgtggcagagcgc
tttggtggccaagtaaatgacacattatcaattgaaaatatcattggtacaaaagcaaca
gaaggtcctcaattcgtttcaagcttagaagggcatgtagcagattatccaattgaagtg
atgaaatctcaacgcgtatccagcatagtacgtaaagagcaggtggaagtagtgcttgaa
aatggtgcagtgttaaaaggaaaaactgttatcctttcaacaggagccagataccgccaa
ttaaatgtaccaggggaagaagcgttcaaaaataaaggggtagcatactgcccacactgt
gatggtccaatcttcaaaggaaaaaatgttgccgttgtaggtggcggtaattcgggtgtt
gaagcagctatagacttagcaggaatagttaatcatgtaacagtgcttcagcataatgat
gagcttaaagcggatcaagtcctacaggagcgtttacatagcttatctaatgtaactgta
ctaacaaatgcttccacacagaaaattacaggtacggataaagtaaacggtcttacgtac
ttagatcgtgtaacaggagaagtacatcacattgaattagaaggcgtatttgttcaaatc
ggtctattaccaaataccgagtttttacaaggtacaattgatttaaacgcacatggagaa
ataattatagacaagcatggagcaacaagcatgccaggagtatttgctgctggtgactgt
acagacacagcgtacaaacaaatcatcatctcaatgggaactggtgcaacagcagcgcta
ggagcatttgattatatgattcgtaacatagctccctcaaattctgaacttgttaaagtt
taa

DBGET integrated database retrieval system