KEGG   Psychrobacillus sp. PB01: PB01_07870Help
Entry
PB01_07870        CDS       T06231                                 

Definition
(GenBank) 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN
  KO
K06941  23S rRNA (adenine2503-C2)-methyltransferase [EC:2.1.1.192]
Organism
psyo  Psychrobacillus sp. PB01
Brite
KEGG Orthology (KO) [BR:psyo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:psyo03009]
    PB01_07870
Enzymes [BR:psyo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.192  23S rRNA (adenine2503-C2)-methyltransferase
     PB01_07870
Ribosome biogenesis [BR:psyo03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    PB01_07870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM Fer4_14 Fer4_12
Motif
Other DBs
NCBI-ProteinID: QFF98754
UniProt: A0A5J6SPR1
LinkDB All DBs
Position
1740119..1741186
Genome map
AA seq 355 aa AA seqDB search
MKKSIYGLTKDQLIEWLLERGQKKFRAEQVWDWLYIKRVQSFEEMNNVNKDCLQILEDNF
VIQTLKQSVKQESADGTIKFLFEMSDGNLIETVLMRFNYGLSVCVTTQVGCNIGCSFCAS
GLLKKNRDLDSGEIVGQIMKVQEHLDQLGKSERVSHIVVMGIGEPFDNYTNLMSFLRVVN
DQKGLAIGARHITVSTSGLAKKIIDFANENIQVNLAVSLHAPNDELRTRIMVINKAFPIE
KVMAAVDYYLEKTNRRITFEYILLRDVNDHVEEAHQLAKLLENKRHLSYVNLIPYNPVDE
HGQYQRSSEESISAFFQTLKNKGINCGVRMEQGTDIDAACGQLRSKQIKKEKTTV
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatcaatatatggtctcactaaagatcagttaatagagtggttactagaacgt
ggccagaaaaaatttcgagcggaacaggtttgggattggttatatattaaaagagtacag
agctttgaagaaatgaataatgtgaacaaggactgtcttcaaatattagaggataatttt
gtcattcaaacattaaaacagtctgtcaaacaggaatcggctgatggaacgattaaattt
ttatttgaaatgtcagatgggaatctaattgaaactgtattgatgcgattcaattatggt
ttatccgtttgtgtaactacacaagttggctgtaatataggttgcagtttttgtgcgagt
ggattactaaagaaaaaccgagatttggattctggtgaaatcgttggtcaaattatgaaa
gtacaagaacatttagatcagcttggtaagagtgaacgagttagtcatatagttgttatg
ggcataggagaaccattcgataactacacgaatttaatgagtttcttacgtgttgtaaac
gatcaaaaaggacttgcaattggagctagacatattacagtttctacaagtggtcttgcg
aaaaaaattattgactttgctaacgaaaacattcaagtaaatcttgcggtatcattgcat
gctcctaacgatgaacttcgtacacgtattatggtgattaataaagccttcccgatcgaa
aaagttatggctgcggtagattattatttagaaaaaacaaaccgacgaattacgtttgaa
tatatattactaagagatgtcaatgaccatgtagaagaagcgcaccaacttgctaaactt
cttgaaaacaaacgtcatttgtcctatgtaaacttgattccttataacccggtagatgag
cacggtcaatatcaacgtagctcagaagaatccatcagcgcattcttccaaacactgaaa
aacaaagggattaactgcggagttcgcatggaacaagggacagatatagacgctgcatgt
ggacaacttcgaagtaaacaaattaaaaaagaaaaaacaacagtataa

DBGET integrated database retrieval system