KEGG   Pseudomonas syringae CC1557: N018_00660Help
Entry
N018_00660        CDS       T03014                                 

Definition
(GenBank) acetylornithine deacetylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
psyr  Pseudomonas syringae CC1557
Pathway
psyr00220  Arginine biosynthesis
psyr01100  Metabolic pathways
psyr01110  Biosynthesis of secondary metabolites
psyr01130  Biosynthesis of antibiotics
psyr01210  2-Oxocarboxylic acid metabolism
psyr01230  Biosynthesis of amino acids
Module
psyr_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:psyr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    N018_00660
Enzymes [BR:psyr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     N018_00660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: AHG38831
UniProt: W0MPS8
LinkDB All DBs
Position
complement(139823..140977)
Genome map
AA seq 384 aa AA seqDB search
MSASRELLARLVAFDTTSRESNLALIDFVRDYLGRFGVSCELIYNAQKTKANLFATIGPA
DVPGIALSGHTDVVPVDGQPWTFPPFELSEADGKLYGRGTADMKGYIACVLALVPALTRA
SLHMPVHIALSYDEEVGCLGVRSLLASLRSRPVKPMLCVIGEPTELKPVLGHKGKIAVRC
DVHGAACHSAHAPSGVNAIEYAAQLIGELGRLGEALRAADALDERFDPPFSTIQTGVISG
GTALNIVPEQCRFDFEVRALPTLDPQQIVTAMHAYAEQKLLPVMQAVSARSEIRFTELSS
YPGLDIPLHNHAAELIASFCGSRAFGTVAFGTEGGLFDQSGIPAVVCGPGSMEQGHKPDE
FISVEQLEACDEMLKRVLGFVSRS
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgagtgccagccgcgagctgctggcaaggctggtggccttcgacaccacaagtcgcgaa
tcgaatctggccttgatcgacttcgtgagggattacctcggacgctttggcgtctcctgc
gagctgatctacaacgcgcagaagaccaaggccaatctgttcgccaccatcggcccggct
gacgtgccaggcatcgcattgtccggccacactgacgtggtgccggtcgacggacagcca
tggacgttcccgccgttcgaactgagcgaagcggatggcaaactctacggccgtggtacc
gcggacatgaaaggctacatcgcctgtgtgctggcgctggttccggcgttgacccgggca
tcgctgcacatgccggtgcatatcgcgctgtcctacgacgaggaggtgggttgcctgggc
gtgcgctcgctactggcttcgcttcggtcgcggccagtgaagccgatgctgtgtgtgatc
ggcgagccgacggagctgaagccagtgctcggtcacaagggcaagatcgcggtgcgctgc
gatgtacacggtgctgcatgccactcggcccacgcgcccagtggcgtcaacgccattgaa
tatgcggcgcagttgatcggtgaactgggtcgcctgggcgaggcgttacgggcagctgac
gcccttgacgagcgctttgatccgccgttttcgaccattcagaccggcgtgatcagcggc
ggtacggccttgaacatcgtgcccgagcagtgccgtttcgatttcgaagtgcgtgcgctc
cccaccctggacccgcaacagatcgtcactgccatgcacgcctacgccgagcaaaaactg
ttgccggtcatgcaggcggtcagtgctcggagcgagattcgcttcacggaactgtcgagc
tatccggggctggatattcccctgcacaaccacgcggcggaactgattgccagcttctgc
ggctcgcgggcattcggcacggttgccttcggaaccgaaggcggattgttcgaccaatcg
ggcattcctgccgtggtctgcgggccgggcagcatggagcagggacacaaaccggacgag
ttcattagcgtcgaacagcttgaggcctgtgacgagatgctgaagcgggtgctgggattt
gtatcccgctcataa

DBGET integrated database retrieval system