KEGG   Pseudomonas syringae CC1557: N018_04715Help
Entry
N018_04715        CDS       T03014                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
psyr  Pseudomonas syringae CC1557
Pathway
psyr00473  D-Alanine metabolism
psyr00550  Peptidoglycan biosynthesis
psyr01100  Metabolic pathways
psyr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:psyr00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    N018_04715
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    N018_04715
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    N018_04715
Enzymes [BR:psyr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     N018_04715
Peptidoglycan biosynthesis and degradation proteins [BR:psyr01011]
 Precursor biosynthesis
  Amino acid ligase
   N018_04715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 ATPgrasp_Ter ATPgrasp_YheCD TTL ATPgrasp_ST GARS_A
Motif
Other DBs
NCBI-ProteinID: AHG39580
UniProt: W0MQR7
LinkDB All DBs
Position
986401..987360
Genome map
AA seq 319 aa AA seqDB search
MTALAWSSLCSTLEPKSFGRVAVLFGGKSAEREVSLNSGQAVLKALLDAGVDAFGVDVGV
DFLQRLVSEKIDRAFIVLHGRGGEDGTMQGLLECLEIPYTGSGVLASALAMDKLRTKQVW
QSLGLPTPLHAVLENESDCICAATELGFPLIVKPAHEGSSIGMAKVSSVDELIAAWKAAS
TYDSQVLVEQWIQGPEFTVASLRGQVLPPIGLGTPHSFYDYDAKYLASDTQYRIPCGLGD
TQEQELKQLAARACEAIGIAGWARTDVMQDAQGKFWLLEVNTVPGMTDHSLVPMAARAAG
LDFQQLVLAILADSVPVRG
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgacagcccttgcctggtcttccctgtgctcgacactcgagccgaaaagcttcggccgc
gttgccgtgctcttcggcggcaagagtgccgagcgggaagtgtccctgaactcggggcag
gcggtactcaaggcgctgctcgacgctggcgtggatgcgttcggcgtcgatgtgggcgtt
gatttcctgcagcgactggtcagcgagaagatcgaccgcgcctttatcgttttgcacgga
cggggcggcgaagacggcactatgcaaggcctgctggagtgcctggaaatcccttatacc
ggcagtggcgtactggcgtcggcactggccatggacaagctgcggaccaagcaggtctgg
cagagtctgggcctgccaaccccgctgcacgccgtgctcgaaaacgagagcgattgtatt
tgcgccgcgacggaactgggcttccctttgatcgtcaaaccggcccatgaaggttcaagt
atcggtatggccaaggtgagcagcgtcgatgaattgatcgccgcctggaaagccgccagt
acctacgattcgcaagtgttggtcgaacagtggattcaggggccggagttcactgttgcg
tctctgcgtggccaggtattgcctcccataggcctgggcacacctcacagcttttatgat
tacgacgccaagtacctggcctccgatacccagtaccggatcccgtgcgggcttggtgat
acgcaggaacaggaactcaaacaactcgctgcacgtgcttgcgaagccatcggcattgca
ggctgggcgcgcacggatgtgatgcaggatgcgcagggcaagttctggctgctggaagtg
aacactgtaccgggcatgaccgatcacagtctggtgccgatggcggcacgcgctgcgggc
ctggattttcagcaactggtgttggcgattctggccgacagcgttccggtgagagggtaa

DBGET integrated database retrieval system