KEGG   Pseudomonas syringae CC1557: N018_09875Help
Entry
N018_09875        CDS       T03014                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
psyr  Pseudomonas syringae CC1557
Pathway
psyr00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:psyr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    N018_09875
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:psyr01002]
    N018_09875
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:psyr01011]
    N018_09875
Enzymes [BR:psyr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     N018_09875
   3.4.21  Serine endopeptidases
    3.4.21.-  
     N018_09875
Peptidases and inhibitors [BR:psyr01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   N018_09875
Peptidoglycan biosynthesis and degradation proteins [BR:psyr01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   N018_09875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2 DUF2997 SdpA
Motif
Other DBs
NCBI-ProteinID: AHG40537
UniProt: W0MQ33
LinkDB All DBs
Position
complement(2115788..2117254)
Genome map
AA seq 488 aa AA seqDB search
MIKSLRPLLLASMLLPLALPAHAAVINTTLPPKVQQALKASKLSDDALSLVMLPLNGPGT
PTVFNADVSVNPASTMKLITTYAALEMLGPTHQWKTEFFTDGTLSNGVLRGNLYLKGGGD
PKLNMEKLWLLMRDLRANGVQQVTGDLVLDRSHFVQPQLPVFNDDGNDENKPFLVKPDSL
MVNLKALRFVTRNDDGRILVSVEPPIATIRIDNQVKASASKQCTGDVRYNPVTQPDGSVN
VTVTGQLGNGCNSQTYLSLLDHPTYTAGAVRAIWQELGGTIQGKDRVGVLPGNAKLLAKA
FSPDLVEVIRDINKFSNNTMAQQLFLSLGEEFRNEADGDDGKAAQRVIRQWLAKKGITAP
HLVMENGSGLSRAERVSAREMAVILQAAWRSPYAAEFMSSMPLAGLDGTMRKRLKRTPLL
GEAHIKTGTLNTVRAIAGFSRDNNGNTWAVVAILNDPRPFGASSILDEVLIDLYRQPKLA
STTVSIQQ
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagtcgctacgtccattgctgctcgcttcgatgcttttgcctctggctctcccc
gcccacgctgccgtcatcaacaccacgctgccccccaaggttcaacaggctctgaaagcc
agcaaactcagcgatgatgcgctctcgctggtcatgctgccactcaacggtccaggtaca
ccgaccgtgttcaatgccgatgtgtcggtgaatccggcctccaccatgaagctgatcacc
acctacgctgcgctggaaatgctcggcccgacccaccagtggaaaaccgaattcttcacc
gatggcaccctaagcaacggcgtactgcgcggcaacctgtacctcaagggcggcggcgac
cccaagctgaacatggaaaaactctggctattgatgcgtgatctgcgtgccaacggtgtg
caacaggtgaccggcgatctggtactggatcgcagccacttcgtacaaccgcaactgccg
gtgttcaacgatgacggcaacgacgagaacaagccgtttctggtcaaacccgactcgctg
atggtcaacctcaaggccctgcgcttcgtgacccgcaacgatgacggccggattctggtg
tcggtggagccgccgatcgccaccatccgtatcgacaaccaggtcaaggccagtgcctcc
aaacaatgcaccggcgacgtgcgctacaacccggtgacgcaaccggacggcagcgtcaat
gtaacggtgaccggccaactgggtaacggctgcaactcgcagacctatctgtccctgctc
gatcacccgacctacaccgcaggcgcggtacgcgccatctggcaggaactgggcggcacc
attcagggcaaggatcgcgtcggcgtgctgcccggcaacgccaagctgctggccaaggca
ttctcgccagacctggtggaagtcatccgtgacatcaacaaattcagcaacaacaccatg
gcccagcagctattcctcagcctgggcgaagagtttcgcaacgaagccgacggcgacgac
ggcaaggctgcgcaacgagtgatccgtcagtggctggcgaaaaaaggtatcactgcgccg
catctggtcatggaaaacggttccgggctgtcccgcgcagaacgcgtcagcgcccgtgaa
atggcagttatcctgcaagccgcgtggcgcagcccgtatgccgccgaattcatgagttca
atgccactcgccgggctcgacggaacgatgcgcaaacgcctcaagcgcacgccactgctg
ggcgaggcccatatcaagaccggcacgttgaataccgtgcgcgccatcgccggattcagc
cgcgacaacaacggcaatacctgggcggtagtggccattctcaatgatccacgccccttc
ggagcatcgtcgattctggacgaagtactgatcgatctgtaccgccagcccaaactggcc
agtaccacggtatcgatccagcagtaa

DBGET integrated database retrieval system